Protein Family IF06790
Metagenome
Isolate
257
Members
105
Samples
229
Scaffolds
407.04
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_090942|Ga0466722_090942_339_1820
- Length
- 493 aa
- Sequence
- VNKKEVKKQQGAGDGQRKSPDFFFYGKHNTRKSDNYGDKFQSAHAEQFVLKKIEYNVHKLKIMIGLLILMQIYSIFAVYKPNDMILNYIWIAFFLIAFVVGICKVIFTGDLGVFTEMMDAVFSAAKNGFEISLGLTGVLSLWLGFMKIGERGGAVNFLSRMGAPIFSRLFPDIPKGHPATGSIFMNIAANMLNLDNAATPLGLKAMKELQELNPQKDTASNPMIMFIVLNASGLIIIPVTLMVYRAQMGAANPADVFMPLMIATSSATLVGVLFICIRQKINLLDKVLLGFFGSAAIVLLGIVWLLQSLSQEQLAVYSSFFANTLLFSIIIAFLIAGIRKKINVYDAFIEGAKEGFKTAVLIIPFLIAMLIAIALFRVSGAMTFVTDGLAYLVSACGLPADWVDAVPTALMKPLSGNASRGMMLDAMQTYGADSFTGRLSSIVQGSTDTTFYIVAVYYGAVGIKNTRYTIPGALLADLTGAVAAIFVCYLFFG
Sample Types
Isolate
10.9%
Metagenome
89.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.2%
Kalotermitidae
14.4%
Unclassified
13.4%
Blattidae
10.3%
Termopsidae
4.1%
Drosophilidae
4.1%
Armadillidiidae
4.1%
Rhinotermitidae
3.1%
Hydrophilidae
2.1%
Passalidae
2.1%
Hodotermitidae
1.0%
Formicidae
1.0%
Bombycidae
1.0%
Taxonomy
Archaea
0
Bacteria
239
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 2 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 3 | 2820714932 | Unclassified Fibrobacteres Nc150P4bin10 | Isolate | Unclassified |
| 4 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 18 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 19 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 33 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 37 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 42 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 43 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 44 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 45 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 46 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 47 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 48 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 49 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 50 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 51 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 54 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 58 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 59 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 60 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 61 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 62 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 63 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 64 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 65 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 66 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 67 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 68 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 69 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 70 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 71 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 72 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 73 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 74 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 75 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 76 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 77 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 78 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 79 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 80 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 81 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 82 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 83 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 84 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 85 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 86 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 87 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 88 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 89 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 90 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 91 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 92 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 93 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 94 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 95 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 96 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 97 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 98 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 99 | 2778260939 | Unclassified Fibrobacteres Co191P4bin13 | Isolate | Unclassified |
| 100 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 101 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 102 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 103 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 104 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 105 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_077119 | 3300042614 | Bacteria | 14106 |
| 2 | Ga0466711_082855 | 3300042615 | Bacteria | 19507 |
| 3 | Ga0466726_076133 | 3300042619 | Bacteria | 50177 |
| 4 | Ga0466729_013000 | 3300042621 | Bacteria | 2378 |
| 5 | Ga0466714_013147 | 3300042603 | Bacteria | 13940 |
| 6 | Ga0466734_111748 | 3300042623 | Bacteria | 11208 |
| 7 | Ga0466703_020008 | 3300042636 | Bacteria | 4661 |
| 8 | Ga0466703_126324 | 3300042636 | Bacteria | 3988 |
| 9 | Ga0466703_263173 | 3300042636 | Bacteria | 2004 |
| 10 | Ga0466704_123413 | 3300042643 | Bacteria | 2690 |
| 11 | Ga0466709_113941 | 3300042648 | Bacteria | 20029 |
| 12 | Ga0466692_073280 | 3300042591 | Bacteria | 28565 |
| 13 | IMNBL1DRAFT_c0001157 | 3300000062 | Bacteria | 20093 |
| 14 | JGI24698J34947_10000589 | 3300002449 | Unclassified | 17293 |
| 15 | JGI24698J34947_10031794 | 3300002449 | Unclassified | 2775 |
| 16 | Ga0068302_10076620 | 3300005071 | Bacteria | 3835 |
| 17 | Ga0072941_1031030 | 3300005201 | Bacteria | 3222 |
| 18 | Ga0074263_108075 | 3300005485 | Unclassified | 1516 |
| 19 | Ga0104045_1020539 | 3300007085 | Bacteria | 1814 |
| 20 | Ga0466697_188676 | 3300042611 | Bacteria | 5105 |
| 21 | Ga0466705_015127 | 3300042612 | Bacteria | 5773 |
| 22 | Ga0466705_043883 | 3300042612 | Bacteria | 44680 |
| 23 | Ga0123354_10000186 | 3300010882 | Bacteria | 52457 |
| 24 | Ga0466711_328409 | 3300042615 | Bacteria | 2251 |
| 25 | Ga0466718_121140 | 3300042617 | Bacteria | 12788 |
| 26 | Ga0466723_048609 | 3300042618 | Bacteria | 21511 |
| 27 | Ga0466706_077732 | 3300042599 | Bacteria | 23766 |
| 28 | Ga0466706_151978 | 3300042599 | Bacteria | 59315 |
| 29 | Ga0466706_259237 | 3300042599 | Bacteria | 35111 |
| 30 | Ga0466707_136654 | 3300042601 | Bacteria | 15946 |
| 31 | Ga0466707_144321 | 3300042601 | Bacteria | 17726 |
| 32 | Ga0466713_118699 | 3300042602 | Bacteria | 4357 |
| 33 | Ga0466714_008101 | 3300042603 | Bacteria | 18228 |
| 34 | Ga0466719_114071 | 3300042606 | Bacteria | 2976 |
| 35 | Ga0466719_203303 | 3300042606 | Bacteria | 4273 |
| 36 | Ga0466735_089701 | 3300042624 | Bacteria | 3874 |
| 37 | Ga0466735_149185 | 3300042624 | Bacteria | 7270 |
| 38 | Ga0466704_027068 | 3300042643 | Bacteria | 38856 |
| 39 | Ga0466704_110885 | 3300042643 | Bacteria | 6051 |
| 40 | Ga0466704_256671 | 3300042643 | Bacteria | 7340 |
| 41 | Ga0466725_230967 | 3300042654 | Bacteria | 12570 |
| 42 | Ga0466727_005176 | 3300042655 | Bacteria | 6823 |
| 43 | Ga0466690_118535 | 3300042590 | Bacteria | 11335 |
| 44 | Ga0466692_073863 | 3300042591 | Bacteria | 38781 |
| 45 | Ga0466694_019493 | 3300042594 | Unclassified | 4925 |
| 46 | Ga0466699_065494 | 3300042597 | Bacteria | 8747 |
| 47 | 2227477694 | 2225789004 | Bacteria | 4572 |
| 48 | IMNBL1DRAFT_c0020392 | 3300000062 | Bacteria | 2686 |
| 49 | JGI24698J34947_10010815 | 3300002449 | Bacteria | 5009 |
| 50 | JGI24695J34938_10048751 | 3300002450 | Bacteria | 1864 |
| 51 | JGI24699J35502_11134056 | 3300002509 | Bacteria | 27277 |
| 52 | Ga0072940_1026458 | 3300005200 | Unclassified | 16283 |
| 53 | Ga0072941_1001712 | 3300005201 | Bacteria | 39008 |
| 54 | Ga0072941_1003412 | 3300005201 | Bacteria | 32876 |
| 55 | Ga0104050_1030936 | 3300007153 | Bacteria | 2853 |
| 56 | Ga0466733_214103 | 3300042659 | Bacteria | 1344 |
| 57 | Ga0123355_10013247 | 3300009826 | Bacteria | 12817 |
| 58 | Ga0466711_032287 | 3300042615 | Bacteria | 10941 |
| 59 | Ga0466711_269012 | 3300042615 | Bacteria | 13793 |
| 60 | Ga0466715_171247 | 3300042616 | Bacteria | 13328 |
| 61 | Ga0466715_329305 | 3300042616 | Bacteria | 8640 |
| 62 | Ga0466723_157979 | 3300042618 | Bacteria | 3096 |
| 63 | Ga0466707_132910 | 3300042601 | Bacteria | 4745 |
| 64 | Ga0466716_167796 | 3300042605 | Bacteria | 5058 |
| 65 | Ga0466720_162803 | 3300042607 | Bacteria | 68552 |
| 66 | Ga0466721_063635 | 3300042608 | Bacteria | 17608 |
| 67 | Ga0466731_013507 | 3300042622 | Bacteria | 31130 |
| 68 | Ga0466703_087985 | 3300042636 | Bacteria | 7664 |
| 69 | Ga0466703_242416 | 3300042636 | Bacteria | 29100 |
| 70 | Ga0466703_261827 | 3300042636 | Bacteria | 4327 |
| 71 | Ga0466703_402408 | 3300042636 | Bacteria | 12984 |
| 72 | Ga0466709_233448 | 3300042648 | Bacteria | 27682 |
| 73 | Ga0466724_29445 | 3300042649 | Bacteria | 11749 |
| 74 | Ga0160433_100568 | 3300012846 | Unclassified | 16022 |
| 75 | Ga0264413_119546 | 3300024493 | Bacteria | 2681 |
| 76 | Ga0265387_1003961 | 3300024582 | Bacteria | 2030 |
| 77 | Ga0466690_192766 | 3300042590 | Bacteria | 18718 |
| 78 | Ga0466694_210127 | 3300042594 | Bacteria | 5622 |
| 79 | Ga0466696_106168 | 3300042596 | Bacteria | 4265 |
| 80 | 2227178028 | 2225789004 | Bacteria | 8096 |
| 81 | 2227450255 | 2225789004 | Bacteria | 5423 |
| 82 | 2230929935 | 2228664001 | Bacteria | 10615 |
| 83 | Ga0104019_1001297 | 3300007150 | Bacteria | 3253 |
| 84 | Ga0466733_007268 | 3300042659 | Bacteria | 11803 |
| 85 | Ga0123354_10029846 | 3300010882 | Bacteria | 8570 |
| 86 | Ga0466723_016511 | 3300042618 | Bacteria | 28122 |
| 87 | Ga0466723_041675 | 3300042618 | Bacteria | 6957 |
| 88 | Ga0466728_029886 | 3300042620 | Bacteria | 13776 |
| 89 | Ga0466728_380545 | 3300042620 | Bacteria | 7706 |
| 90 | Ga0466706_231498 | 3300042599 | Bacteria | 4140 |
| 91 | Ga0466707_158488 | 3300042601 | Bacteria | 2475 |
| 92 | Ga0466713_078325 | 3300042602 | Bacteria | 1943 |
| 93 | Ga0466717_129772 | 3300042604 | Bacteria | 15738 |
| 94 | Ga0466721_081177 | 3300042608 | Bacteria | 2242 |
| 95 | Ga0466722_076936 | 3300042609 | Bacteria | 12170 |
| 96 | Ga0466722_090942 | 3300042609 | Bacteria | 1938 |
| 97 | Ga0466722_120295 | 3300042609 | Bacteria | 3119 |
| 98 | Ga0466702_084263 | 3300042635 | Bacteria | 13328 |
| 99 | Ga0466704_330242 | 3300042643 | Bacteria | 11401 |
| 100 | Ga0466724_28289 | 3300042649 | Bacteria | 3859 |
| 101 | Ga0466727_153941 | 3300042655 | Bacteria | 11273 |
| 102 | Ga0466727_342006 | 3300042655 | Bacteria | 6229 |
| 103 | Ga0160445_100254 | 3300012847 | Bacteria | 37718 |
| 104 | Ga0160443_101159 | 3300012848 | Bacteria | 10321 |
| 105 | Ga0466690_059471 | 3300042590 | Bacteria | 5078 |
| 106 | Ga0466694_068335 | 3300042594 | Bacteria | 3044 |
| 107 | IMNBL1DRAFT_c0009846 | 3300000062 | Bacteria | 4661 |
| 108 | AustNasuHG_c1003957 | 3300000089 | Bacteria | 5336 |
| 109 | JGI24705J35276_12237349 | 3300002504 | Bacteria | 10779 |
| 110 | JGI24696J40584_12954273 | 3300002834 | Bacteria | 2610 |
| 111 | Ga0068305_10210499 | 3300005083 | Bacteria | 2488 |
| 112 | Ga0072941_1000047 | 3300005201 | Bacteria | 107170 |
| 113 | Ga0104050_1004621 | 3300007153 | Unclassified | 5913 |
| 114 | Ga0466733_093258 | 3300042659 | Bacteria | 8899 |
| 115 | Ga0123357_10167633 | 3300009784 | Bacteria | 2610 |
| 116 | Ga0466710_304264 | 3300042613 | Bacteria | 6817 |
| 117 | Ga0466712_181293 | 3300042614 | Bacteria | 23427 |
| 118 | Ga0466711_070021 | 3300042615 | Bacteria | 21814 |
| 119 | Ga0466715_029715 | 3300042616 | Bacteria | 12268 |
| 120 | Ga0466715_079178 | 3300042616 | Bacteria | 19122 |
| 121 | Ga0466715_458052 | 3300042616 | Bacteria | 7952 |
| 122 | Ga0466726_215985 | 3300042619 | Bacteria | 10940 |
| 123 | Ga0466706_143100 | 3300042599 | Bacteria | 15232 |
| 124 | Ga0466707_116920 | 3300042601 | Bacteria | 7648 |
| 125 | Ga0466716_279502 | 3300042605 | Bacteria | 16930 |
| 126 | Ga0466719_452374 | 3300042606 | Bacteria | 4691 |
| 127 | Ga0466720_135191 | 3300042607 | Unclassified | 32149 |
| 128 | Ga0466734_132042 | 3300042623 | Bacteria | 2856 |
| 129 | Ga0466724_19702 | 3300042649 | Bacteria | 254661 |
| 130 | Ga0466692_070755 | 3300042591 | Bacteria | 7991 |
| 131 | Ga0466691_095154 | 3300042593 | Bacteria | 7390 |
| 132 | Ga0466694_019978 | 3300042594 | Bacteria | 5466 |
| 133 | Ga0466696_021785 | 3300042596 | Bacteria | 6045 |
| 134 | JGI24698J34947_10001279 | 3300002449 | Bacteria | 13176 |
| 135 | JGI24695J34938_10002487 | 3300002450 | Unclassified | 14050 |
| 136 | Ga0072940_1011398 | 3300005200 | Bacteria | 23293 |
| 137 | Ga0072941_1031031 | 3300005201 | Bacteria | 7242 |
| 138 | Ga0072941_1041070 | 3300005201 | Bacteria | 2246 |
| 139 | Ga0102739_1004490 | 3300007095 | Bacteria | 1966 |
| 140 | Ga0104050_1004087 | 3300007153 | Bacteria | 3662 |
| 141 | Ga0123356_10350706 | 3300010049 | Bacteria | 1599 |
| 142 | Ga0466710_243130 | 3300042613 | Bacteria | 1527 |
| 143 | Ga0466712_149396 | 3300042614 | Unclassified | 9480 |
| 144 | Ga0466711_100503 | 3300042615 | Bacteria | 21089 |
| 145 | Ga0466715_347496 | 3300042616 | Bacteria | 3336 |
| 146 | Ga0466726_041728 | 3300042619 | Bacteria | 12106 |
| 147 | Ga0466726_149549 | 3300042619 | Unclassified | 6856 |
| 148 | Ga0466707_021176 | 3300042601 | Bacteria | 8550 |
| 149 | Ga0466713_093700 | 3300042602 | Bacteria | 6121 |
| 150 | Ga0466716_153824 | 3300042605 | Bacteria | 38013 |
| 151 | Ga0466731_166368 | 3300042622 | Bacteria | 10651 |
| 152 | Ga0466724_11699 | 3300042649 | Unclassified | 11459 |
| 153 | Ga0466708_070671 | 3300042652 | Bacteria | 8991 |
| 154 | Ga0466708_307050 | 3300042652 | Bacteria | 51768 |
| 155 | Ga0466725_020687 | 3300042654 | Bacteria | 5149 |
| 156 | Ga0466725_208944 | 3300042654 | Bacteria | 7227 |
| 157 | Ga0160433_100111 | 3300012846 | Bacteria | 79834 |
| 158 | Ga0160445_100311 | 3300012847 | Bacteria | 29371 |
| 159 | Ga0466657_210485 | 3300042582 | Bacteria | 22461 |
| 160 | Ga0466690_189517 | 3300042590 | Bacteria | 7460 |
| 161 | Ga0466692_100010 | 3300042591 | Bacteria | 2750 |
| 162 | Ga0466694_005196 | 3300042594 | Bacteria | 5282 |
| 163 | Ga0466695_039135 | 3300042595 | Bacteria | 4432 |
| 164 | Ga0466696_078541 | 3300042596 | Bacteria | 9974 |
| 165 | JGI24698J34947_10000260 | 3300002449 | Unclassified | 22485 |
| 166 | JGI24697J35500_11270831 | 3300002507 | Unclassified | 4322 |
| 167 | Ga0072941_1024972 | 3300005201 | Bacteria | 4412 |
| 168 | Ga0466705_139730 | 3300042612 | Bacteria | 2316 |
| 169 | Ga0466733_008388 | 3300042659 | Bacteria | 10408 |
| 170 | Ga0466733_045800 | 3300042659 | Bacteria | 1792 |
| 171 | Ga0466718_027010 | 3300042617 | Bacteria | 16236 |
| 172 | Ga0466729_001890 | 3300042621 | Bacteria | 10348 |
| 173 | Ga0466701_100779 | 3300042598 | Bacteria | 3507 |
| 174 | Ga0466706_252340 | 3300042599 | Bacteria | 21739 |
| 175 | Ga0466700_307292 | 3300042600 | Bacteria | 1614 |
| 176 | Ga0466713_025722 | 3300042602 | Bacteria | 16105 |
| 177 | Ga0466719_423015 | 3300042606 | Bacteria | 2802 |
| 178 | Ga0466722_092243 | 3300042609 | Bacteria | 6997 |
| 179 | Ga0466729_198321 | 3300042621 | Bacteria | 8895 |
| 180 | Ga0466735_115616 | 3300042624 | Bacteria | 2987 |
| 181 | Ga0466735_199068 | 3300042624 | Bacteria | 6053 |
| 182 | Ga0466730_058791 | 3300042625 | Bacteria | 120456 |
| 183 | Ga0466703_095912 | 3300042636 | Bacteria | 1556 |
| 184 | Ga0466703_244414 | 3300042636 | Bacteria | 4676 |
| 185 | Ga0466704_613858 | 3300042643 | Bacteria | 50189 |
| 186 | Ga0466709_214621 | 3300042648 | Bacteria | 11712 |
| 187 | Ga0160468_100083 | 3300012819 | Bacteria | 120536 |
| 188 | Ga0466657_177393 | 3300042582 | Bacteria | 1766 |
| 189 | Ga0466690_162599 | 3300042590 | Bacteria | 26022 |
| 190 | Ga0466692_165865 | 3300042591 | Bacteria | 23835 |
| 191 | Ga0466691_039437 | 3300042593 | Bacteria | 17380 |
| 192 | Ga0466694_000566 | 3300042594 | Bacteria | 10686 |
| 193 | Ga0466696_240564 | 3300042596 | Bacteria | 5413 |
| 194 | AustNasuHG_c1000048 | 3300000089 | Bacteria | 30595 |
| 195 | Ga0072941_1002927 | 3300005201 | Unclassified | 18687 |
| 196 | Ga0072941_1031029 | 3300005201 | Bacteria | 5257 |
| 197 | Ga0104048_1000860 | 3300007143 | Bacteria | 5504 |
| 198 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 199 | Ga0466705_149675 | 3300042612 | Bacteria | 5740 |
| 200 | Ga0466732_131306 | 3300042656 | Unclassified | 4352 |
| 201 | Ga0123357_10109644 | 3300009784 | Bacteria | 3526 |
| 202 | Ga0123353_10140639 | 3300010167 | Bacteria | 3867 |
| 203 | Ga0466712_220159 | 3300042614 | Unclassified | 13806 |
| 204 | Ga0466715_107240 | 3300042616 | Bacteria | 39584 |
| 205 | Ga0466701_055658 | 3300042598 | Bacteria | 38151 |
| 206 | Ga0466706_012879 | 3300042599 | Bacteria | 6474 |
| 207 | Ga0466716_258106 | 3300042605 | Bacteria | 11922 |
| 208 | Ga0466719_411648 | 3300042606 | Bacteria | 3084 |
| 209 | Ga0466720_216518 | 3300042607 | Bacteria | 1730 |
| 210 | Ga0466735_104917 | 3300042624 | Bacteria | 4543 |
| 211 | Ga0466703_136825 | 3300042636 | Bacteria | 10514 |
| 212 | Ga0466704_460153 | 3300042643 | Bacteria | 10237 |
| 213 | Ga0466709_018342 | 3300042648 | Bacteria | 4216 |
| 214 | Ga0466724_63872 | 3300042649 | Bacteria | 73403 |
| 215 | Ga0466708_009846 | 3300042652 | Bacteria | 4211 |
| 216 | Ga0466708_142530 | 3300042652 | Bacteria | 17036 |
| 217 | Ga0466727_096909 | 3300042655 | Bacteria | 41286 |
| 218 | Ga0466727_217946 | 3300042655 | Bacteria | 7191 |
| 219 | Ga0466690_143667 | 3300042590 | Bacteria | 13281 |
| 220 | Ga0466690_180311 | 3300042590 | Bacteria | 24767 |
| 221 | Ga0466690_295401 | 3300042590 | Bacteria | 56577 |
| 222 | Ga0466692_147521 | 3300042591 | Bacteria | 4748 |
| 223 | Ga0466691_218237 | 3300042593 | Bacteria | 6303 |
| 224 | Ga0466696_140375 | 3300042596 | Bacteria | 6189 |
| 225 | Ga0466696_267649 | 3300042596 | Bacteria | 36863 |
| 226 | JGI24698J34947_10010051 | 3300002449 | Unclassified | 5185 |
| 227 | JGI24702J35022_10000550 | 3300002462 | Bacteria | 22684 |
| 228 | Ga0072941_1009575 | 3300005201 | Bacteria | 47966 |
| 229 | Ga0123357_10000088 | 3300009784 | Bacteria | 73731 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07670 | Gate | Nucleoside recognition | 134 | 240 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.