Protein Family IF06733
Metagenome
Isolate
622
Members
199
Samples
521
Scaffolds
400.25
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_022157|Ga0466722_022157_52689_54017
- Length
- 442 aa
- Sequence
- MIAEGISNWLDCGLRKAGPAILDIKTVFLYINQNKETMKDFIITEAQTEKAVLVGLMTPQQNDSKVDEYLDELAFLAETAGMTAVKRFKQRLDSPNRTTFVGSGKLQEIKSFLVESEADIVIFDDELSAKQLRNIEKELQVMILDRTSLILDIFARRAQTAYAKTQVELAKYQYMLPRLTRLWTHLERQSGGSRYLRGPGETQLETDRRIIQTKVAKLKRDLEEIDRQMITQRKNRGKMVRTALVGYTNVGKSTLMNILCKSEVFAEDKLFATLDTTVRKMIVGNLPFLLSDTVGFIRKLPTELVESFKSTLDEVREADLLLHIVDISHPGFEEQIEVVEKTLAEIGGGDKPVITIFNKVDAFTFVPKAEDDLTPRTKENASLEELEHTWMNKMGDNGIFISAKNLTNIDRLKNLLYERVKEIHISRYPYNDFLYQQYEEEC
Sample Types
Isolate
16.2%
Metagenome
83.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
19.0%
Termitidae
17.4%
Unclassified
14.7%
Kalotermitidae
7.6%
Formicidae
6.0%
Culicidae
4.9%
Elmidae
4.9%
Drosophilidae
4.3%
Rhinotermitidae
3.3%
Armadillidiidae
3.3%
Apidae
2.7%
Passalidae
1.6%
Hydrophilidae
1.6%
Termopsidae
1.6%
Tenebrionidae
1.1%
Cambaridae
1.1%
Delphacidae
0.5%
Hodotermitidae
0.5%
Daphniidae
0.5%
Aphididae
0.5%
Pyroglyphidae
0.5%
Nephropidae
0.5%
Bombycidae
0.5%
Monophlebidae
0.5%
Kiwaidae
0.5%
Taxonomy
Archaea
0
Bacteria
599
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 2 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 3 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 4 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 5 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 6 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 7 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 8 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 9 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 10 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 11 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 12 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 13 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 14 | 3000336795 | Cardinium endosymbiont of Sogatella furcifera cSfur | Isolate | Delphacidae |
| 15 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 20 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 21 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 22 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 23 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 28 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 29 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 30 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 31 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 32 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 40 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 41 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 42 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 43 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 44 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 45 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 46 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 47 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 48 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 49 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 50 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 51 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 52 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 53 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 54 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 55 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 56 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 57 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 58 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 59 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 60 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 61 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 62 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 63 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 64 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 65 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 66 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 67 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 68 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 69 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 70 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 71 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 72 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 73 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 74 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 75 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 76 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 77 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 78 | 3000153175 | Cardinium endosymbiont of Dermatophagoides farinae UMMZ BMOC 05-0812-001 | Isolate | Pyroglyphidae |
| 79 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 80 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 81 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 82 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 83 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 84 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 85 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 86 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 87 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 88 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 89 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 90 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 91 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 92 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 93 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 94 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 95 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 96 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 97 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 98 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 99 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 100 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 101 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 102 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 103 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 104 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 105 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 106 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 107 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 108 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 109 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 110 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 111 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 112 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 113 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 114 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 115 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 116 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 117 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 118 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 119 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 120 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 121 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 122 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 123 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 124 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 125 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 126 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 127 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 128 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 129 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 130 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 131 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 132 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 133 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 134 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 135 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 136 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 137 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 138 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 139 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 140 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 141 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 142 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 143 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 144 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 145 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 146 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 147 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 148 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 149 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 150 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 151 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 152 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 153 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 154 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 155 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 156 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 157 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 158 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 159 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 160 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 161 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 162 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 163 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 164 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 165 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 166 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 167 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 168 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 169 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 170 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 171 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 172 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 173 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 174 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 175 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 176 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 177 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 178 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 179 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 180 | 2585427656 | Endosymbiont of Llaveia axin axin | Isolate | Monophlebidae |
| 181 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 182 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 183 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 184 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 185 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 186 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 187 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 188 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 189 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 190 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 191 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 192 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 193 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 194 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 195 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 196 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 197 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 198 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 199 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_202875 | 3300042612 | Bacteria | 4027 |
| 2 | Ga0466733_022772 | 3300042659 | Bacteria | 146320 |
| 3 | Ga0160472_101233 | 3300012839 | Bacteria | 8208 |
| 4 | Ga0160444_100018 | 3300012841 | Bacteria | 326466 |
| 5 | Ga0265387_1003197 | 3300024582 | Bacteria | 2280 |
| 6 | Ga0466657_049969 | 3300042582 | Unclassified | 8381 |
| 7 | Ga0466657_305711 | 3300042582 | Bacteria | 6284 |
| 8 | Ga0466657_394574 | 3300042582 | Bacteria | 1428 |
| 9 | Ga0466690_250519 | 3300042590 | Unclassified | 3532 |
| 10 | Ga0466696_041999 | 3300042596 | Bacteria | 11159 |
| 11 | Ga0466696_215596 | 3300042596 | Bacteria | 86390 |
| 12 | Ga0466699_389142 | 3300042597 | Unclassified | 1096 |
| 13 | Ga0123355_10166557 | 3300009826 | Unclassified | 3306 |
| 14 | Ga0123356_10142391 | 3300010049 | Bacteria | 2367 |
| 15 | Ga0123356_10176286 | 3300010049 | Bacteria | 2154 |
| 16 | Ga0123353_10035824 | 3300010167 | Bacteria | 7765 |
| 17 | Ga0123354_10261845 | 3300010882 | Bacteria | 1725 |
| 18 | Ga0466711_133415 | 3300042615 | Bacteria | 7335 |
| 19 | Ga0466711_343868 | 3300042615 | Bacteria | 17050 |
| 20 | Ga0466715_121217 | 3300042616 | Bacteria | 12685 |
| 21 | Ga0466715_619037 | 3300042616 | Bacteria | 3160 |
| 22 | Ga0466718_113349 | 3300042617 | Unclassified | 1117 |
| 23 | Ga0466723_052911 | 3300042618 | Bacteria | 5649 |
| 24 | Ga0466723_118968 | 3300042618 | Bacteria | 5552 |
| 25 | Ga0466726_004455 | 3300042619 | Bacteria | 6120 |
| 26 | Ga0466726_191365 | 3300042619 | Bacteria | 3528 |
| 27 | Ga0466728_413706 | 3300042620 | Bacteria | 32588 |
| 28 | Ga0466729_171550 | 3300042621 | Bacteria | 2986 |
| 29 | Ga0466701_075172 | 3300042598 | Bacteria | 4556 |
| 30 | Ga0466706_152299 | 3300042599 | Bacteria | 38667 |
| 31 | Ga0466706_165084 | 3300042599 | Bacteria | 195712 |
| 32 | Ga0466707_403051 | 3300042601 | Bacteria | 38545 |
| 33 | Ga0466714_001118 | 3300042603 | Unclassified | 3417 |
| 34 | Ga0466714_011913 | 3300042603 | Bacteria | 9635 |
| 35 | Ga0466714_019291 | 3300042603 | Bacteria | 13642 |
| 36 | Ga0466714_101812 | 3300042603 | Unclassified | 10028 |
| 37 | Ga0466714_135077 | 3300042603 | Bacteria | 3725 |
| 38 | Ga0466714_146137 | 3300042603 | Bacteria | 42453 |
| 39 | Ga0466716_216822 | 3300042605 | Bacteria | 2598 |
| 40 | Ga0466716_311338 | 3300042605 | Bacteria | 24204 |
| 41 | Ga0466719_507388 | 3300042606 | Bacteria | 5599 |
| 42 | Ga0466722_022157 | 3300042609 | Bacteria | 77437 |
| 43 | 2227466336 | 2225789004 | Unclassified | 5122 |
| 44 | 2227496307 | 2225789004 | Bacteria | 3924 |
| 45 | 2227510750 | 2225789004 | Bacteria | 18374 |
| 46 | IMNBGM34_c000828 | 3300000036 | Bacteria | 7000 |
| 47 | IMNBL1DRAFT_c0001118 | 3300000062 | Bacteria | 20542 |
| 48 | IMNBL1DRAFT_c0003779 | 3300000062 | Bacteria | 9465 |
| 49 | IMNBL1DRAFT_c0015951 | 3300000062 | Bacteria | 3236 |
| 50 | JGI24702J35022_10014948 | 3300002462 | Bacteria | 4277 |
| 51 | JGI24705J35276_12200601 | 3300002504 | Bacteria | 1604 |
| 52 | Ga0068305_10018050 | 3300005083 | Bacteria | 28356 |
| 53 | Ga0102736_1000702 | 3300007052 | Bacteria | 20603 |
| 54 | Ga0104045_1076170 | 3300007085 | Bacteria | 1731 |
| 55 | Ga0102734_1000657 | 3300007129 | Bacteria | 16087 |
| 56 | Ga0102737_1000052 | 3300007142 | Bacteria | 34662 |
| 57 | Ga0104048_1002963 | 3300007143 | Bacteria | 13174 |
| 58 | Ga0103267_1000586 | 3300007190 | Bacteria | 10704 |
| 59 | Ga0105005_1119953 | 3300007505 | Bacteria | 5108 |
| 60 | Ga0127649_100180 | 3300009460 | Bacteria | 46423 |
| 61 | Ga0466731_192274 | 3300042622 | Bacteria | 3823 |
| 62 | Ga0466731_225622 | 3300042622 | Bacteria | 36027 |
| 63 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 64 | Ga0466703_194871 | 3300042636 | Bacteria | 8853 |
| 65 | Ga0466703_225922 | 3300042636 | Bacteria | 3428 |
| 66 | Ga0466703_246510 | 3300042636 | Bacteria | 8581 |
| 67 | Ga0466703_416796 | 3300042636 | Bacteria | 12962 |
| 68 | Ga0466704_161992 | 3300042643 | Bacteria | 55801 |
| 69 | Ga0466704_233626 | 3300042643 | Bacteria | 73504 |
| 70 | Ga0466704_325157 | 3300042643 | Bacteria | 8872 |
| 71 | Ga0466704_461845 | 3300042643 | Bacteria | 6992 |
| 72 | Ga0466725_425080 | 3300042654 | Bacteria | 39967 |
| 73 | Ga0466705_308399 | 3300042612 | Bacteria | 10128 |
| 74 | Ga0466732_287279 | 3300042656 | Bacteria | 5789 |
| 75 | Ga0466732_444045 | 3300042656 | Bacteria | 4945 |
| 76 | Ga0466733_078921 | 3300042659 | Bacteria | 5050 |
| 77 | Ga0466733_166572 | 3300042659 | Bacteria | 14258 |
| 78 | Ga0466733_187897 | 3300042659 | Bacteria | 13973 |
| 79 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 80 | Ga0466696_057612 | 3300042596 | Bacteria | 41759 |
| 81 | Ga0123355_10182952 | 3300009826 | Bacteria | 3107 |
| 82 | Ga0123356_10375709 | 3300010049 | Bacteria | 1552 |
| 83 | Ga0123353_10001157 | 3300010167 | Bacteria | 32209 |
| 84 | Ga0123353_10031732 | 3300010167 | Bacteria | 8191 |
| 85 | Ga0123353_10099715 | 3300010167 | Bacteria | 4681 |
| 86 | Ga0123353_10131836 | 3300010167 | Bacteria | 4009 |
| 87 | Ga0123354_10048156 | 3300010882 | Bacteria | 6486 |
| 88 | Ga0466710_279572 | 3300042613 | Bacteria | 1640 |
| 89 | Ga0466711_093156 | 3300042615 | Bacteria | 2645 |
| 90 | Ga0466715_050615 | 3300042616 | Bacteria | 31061 |
| 91 | Ga0466723_109995 | 3300042618 | Bacteria | 3112 |
| 92 | Ga0466726_335981 | 3300042619 | Bacteria | 5286 |
| 93 | Ga0466726_448372 | 3300042619 | Bacteria | 1745 |
| 94 | Ga0466706_099059 | 3300042599 | Bacteria | 17501 |
| 95 | Ga0466700_112414 | 3300042600 | Bacteria | 1598 |
| 96 | Ga0466707_255088 | 3300042601 | Bacteria | 14848 |
| 97 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 98 | Ga0466714_064928 | 3300042603 | Bacteria | 1791 |
| 99 | Ga0466714_086328 | 3300042603 | Bacteria | 13155 |
| 100 | Ga0466714_147194 | 3300042603 | Bacteria | 26228 |
| 101 | Ga0466719_094520 | 3300042606 | Bacteria | 2981 |
| 102 | Ga0466719_317167 | 3300042606 | Bacteria | 5389 |
| 103 | Ga0466722_039232 | 3300042609 | Bacteria | 1951 |
| 104 | 2227501299 | 2225789004 | Bacteria | 3796 |
| 105 | JGI24702J35022_10000833 | 3300002462 | Bacteria | 19056 |
| 106 | JGI24702J35022_10026576 | 3300002462 | Bacteria | 3117 |
| 107 | Meta3P_1000502 | 3300002464 | Bacteria | 46775 |
| 108 | JGI24705J35276_12233288 | 3300002504 | Bacteria | 4759 |
| 109 | JGI24696J40584_12961714 | 3300002834 | Bacteria | 53450 |
| 110 | Ga0068305_10001719 | 3300005083 | Bacteria | 59866 |
| 111 | Ga0068305_10029659 | 3300005083 | Bacteria | 21730 |
| 112 | Ga0072941_1132132 | 3300005201 | Bacteria | 5976 |
| 113 | Ga0104045_1020487 | 3300007085 | Bacteria | 1878 |
| 114 | Ga0104048_1003251 | 3300007143 | Bacteria | 8048 |
| 115 | Ga0103267_1003400 | 3300007190 | Bacteria | 7028 |
| 116 | Ga0103268_1000080 | 3300007192 | Bacteria | 31127 |
| 117 | Ga0466734_105114 | 3300042623 | Bacteria | 4195 |
| 118 | Ga0466703_217268 | 3300042636 | Bacteria | 30172 |
| 119 | Ga0466703_306245 | 3300042636 | Bacteria | 4241 |
| 120 | Ga0466709_189802 | 3300042648 | Bacteria | 2637 |
| 121 | Ga0466709_252464 | 3300042648 | Bacteria | 4041 |
| 122 | Ga0466709_399442 | 3300042648 | Bacteria | 10404 |
| 123 | Ga0466724_28891 | 3300042649 | Bacteria | 455231 |
| 124 | Ga0466708_061761 | 3300042652 | Bacteria | 24390 |
| 125 | Ga0466708_063433 | 3300042652 | Bacteria | 3662 |
| 126 | Ga0466708_122468 | 3300042652 | Bacteria | 18369 |
| 127 | Ga0466708_229679 | 3300042652 | Bacteria | 26272 |
| 128 | Ga0466727_130463 | 3300042655 | Bacteria | 6939 |
| 129 | Ga0466727_156011 | 3300042655 | Bacteria | 10929 |
| 130 | Ga0466727_182786 | 3300042655 | Bacteria | 3699 |
| 131 | Ga0466727_235077 | 3300042655 | Bacteria | 1940 |
| 132 | Ga0466697_189263 | 3300042611 | Bacteria | 10138 |
| 133 | Ga0466705_070565 | 3300042612 | Bacteria | 2569 |
| 134 | Ga0466705_115050 | 3300042612 | Bacteria | 20093 |
| 135 | Ga0466733_066810 | 3300042659 | Bacteria | 1697 |
| 136 | Ga0466733_203605 | 3300042659 | Bacteria | 93930 |
| 137 | Ga0160472_100050 | 3300012839 | Bacteria | 194545 |
| 138 | Ga0466657_244709 | 3300042582 | Bacteria | 4312 |
| 139 | Ga0466657_334239 | 3300042582 | Bacteria | 17784 |
| 140 | Ga0466690_127660 | 3300042590 | Bacteria | 9561 |
| 141 | Ga0466690_181777 | 3300042590 | Unclassified | 3795 |
| 142 | Ga0466690_376457 | 3300042590 | Unclassified | 4783 |
| 143 | Ga0466692_067935 | 3300042591 | Bacteria | 92005 |
| 144 | Ga0466691_023594 | 3300042593 | Bacteria | 16897 |
| 145 | Ga0466695_011493 | 3300042595 | Bacteria | 7966 |
| 146 | Ga0466696_088331 | 3300042596 | Bacteria | 38541 |
| 147 | Ga0466696_456684 | 3300042596 | Bacteria | 3995 |
| 148 | Ga0123355_10000865 | 3300009826 | Bacteria | 41779 |
| 149 | Ga0123356_10003048 | 3300010049 | Bacteria | 17709 |
| 150 | Ga0123356_10198828 | 3300010049 | Bacteria | 2042 |
| 151 | Ga0123353_10406263 | 3300010167 | Bacteria | 2024 |
| 152 | Ga0123353_10855982 | 3300010167 | Bacteria | 1245 |
| 153 | Ga0160465_100021 | 3300012803 | Bacteria | 245261 |
| 154 | Ga0466705_487232 | 3300042612 | Bacteria | 11361 |
| 155 | Ga0466710_168555 | 3300042613 | Bacteria | 17866 |
| 156 | Ga0466710_277867 | 3300042613 | Bacteria | 1857 |
| 157 | Ga0466711_361529 | 3300042615 | Bacteria | 5923 |
| 158 | Ga0466715_075255 | 3300042616 | Bacteria | 57351 |
| 159 | Ga0466715_226046 | 3300042616 | Bacteria | 8939 |
| 160 | Ga0466723_022975 | 3300042618 | Bacteria | 36124 |
| 161 | Ga0466723_025203 | 3300042618 | Bacteria | 8693 |
| 162 | Ga0466723_208031 | 3300042618 | Bacteria | 14039 |
| 163 | Ga0466723_251563 | 3300042618 | Bacteria | 4488 |
| 164 | Ga0466728_105299 | 3300042620 | Bacteria | 55474 |
| 165 | Ga0466728_292510 | 3300042620 | Bacteria | 40918 |
| 166 | Ga0466729_123526 | 3300042621 | Bacteria | 33019 |
| 167 | Ga0466729_153515 | 3300042621 | Bacteria | 4099 |
| 168 | Ga0466701_092874 | 3300042598 | Bacteria | 2934 |
| 169 | Ga0466701_102031 | 3300042598 | Bacteria | 201577 |
| 170 | Ga0466706_055649 | 3300042599 | Bacteria | 4867 |
| 171 | Ga0466706_083099 | 3300042599 | Bacteria | 15314 |
| 172 | Ga0466706_115643 | 3300042599 | Bacteria | 11447 |
| 173 | Ga0466706_264354 | 3300042599 | Bacteria | 7489 |
| 174 | Ga0466706_284939 | 3300042599 | Bacteria | 31061 |
| 175 | Ga0466713_064639 | 3300042602 | Bacteria | 150612 |
| 176 | Ga0466713_134411 | 3300042602 | Bacteria | 55260 |
| 177 | Ga0466714_056529 | 3300042603 | Bacteria | 9353 |
| 178 | Ga0466714_080392 | 3300042603 | Bacteria | 5263 |
| 179 | Ga0466714_084672 | 3300042603 | Bacteria | 3226 |
| 180 | Ga0466716_138489 | 3300042605 | Bacteria | 1673 |
| 181 | Ga0466719_025382 | 3300042606 | Bacteria | 5117 |
| 182 | Ga0466719_085693 | 3300042606 | Bacteria | 13259 |
| 183 | JGI24695J34938_10036262 | 3300002450 | Bacteria | 2250 |
| 184 | JGI24702J35022_10050624 | 3300002462 | Bacteria | 2213 |
| 185 | Ga0102739_1000327 | 3300007095 | Bacteria | 10740 |
| 186 | Ga0102734_1000063 | 3300007129 | Bacteria | 59508 |
| 187 | Ga0102734_1001872 | 3300007129 | Bacteria | 5099 |
| 188 | Ga0102740_1000461 | 3300007140 | Bacteria | 11271 |
| 189 | Ga0102740_1000709 | 3300007140 | Bacteria | 8999 |
| 190 | Ga0104048_1171793 | 3300007143 | Bacteria | 1422 |
| 191 | Ga0104019_1030551 | 3300007150 | Bacteria | 5686 |
| 192 | Ga0103267_1002061 | 3300007190 | Bacteria | 5048 |
| 193 | Ga0466735_044872 | 3300042624 | Bacteria | 2158 |
| 194 | Ga0466730_054806 | 3300042625 | Bacteria | 801523 |
| 195 | Ga0466704_040825 | 3300042643 | Bacteria | 11115 |
| 196 | Ga0466704_145177 | 3300042643 | Bacteria | 1682 |
| 197 | Ga0466709_018389 | 3300042648 | Bacteria | 1596 |
| 198 | Ga0466709_204854 | 3300042648 | Bacteria | 33394 |
| 199 | Ga0466709_267796 | 3300042648 | Bacteria | 6537 |
| 200 | Ga0466709_277595 | 3300042648 | Bacteria | 221236 |
| 201 | Ga0466724_29337 | 3300042649 | Unclassified | 3634 |
| 202 | Ga0466724_53521 | 3300042649 | Bacteria | 56861 |
| 203 | Ga0466708_196047 | 3300042652 | Bacteria | 23939 |
| 204 | Ga0466725_102832 | 3300042654 | Bacteria | 30734 |
| 205 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 206 | Ga0466697_256321 | 3300042611 | Bacteria | 2840 |
| 207 | Ga0466705_119782 | 3300042612 | Bacteria | 8898 |
| 208 | Ga0466705_192919 | 3300042612 | Bacteria | 3168 |
| 209 | Ga0466705_353649 | 3300042612 | Bacteria | 7439 |
| 210 | Ga0466732_380641 | 3300042656 | Bacteria | 1196 |
| 211 | Ga0466733_054986 | 3300042659 | Bacteria | 147644 |
| 212 | Ga0466733_070395 | 3300042659 | Bacteria | 8366 |
| 213 | Ga0466733_099683 | 3300042659 | Bacteria | 2399 |
| 214 | Ga0466733_207796 | 3300042659 | Bacteria | 9738 |
| 215 | Ga0160469_100465 | 3300012824 | Bacteria | 18901 |
| 216 | Ga0160441_102231 | 3300012825 | Bacteria | 4137 |
| 217 | Ga0160445_100273 | 3300012847 | Bacteria | 35050 |
| 218 | Ga0160445_105757 | 3300012847 | Bacteria | 2089 |
| 219 | Ga0160457_1001699 | 3300012858 | Bacteria | 5590 |
| 220 | Ga0466656_376352 | 3300042550 | Bacteria | 10306 |
| 221 | Ga0466690_039309 | 3300042590 | Bacteria | 17761 |
| 222 | Ga0466690_148842 | 3300042590 | Bacteria | 22929 |
| 223 | Ga0466692_116713 | 3300042591 | Bacteria | 19215 |
| 224 | Ga0466691_013625 | 3300042593 | Bacteria | 3823 |
| 225 | Ga0466691_026472 | 3300042593 | Bacteria | 14277 |
| 226 | Ga0466694_017032 | 3300042594 | Bacteria | 12535 |
| 227 | Ga0466696_171631 | 3300042596 | Bacteria | 11628 |
| 228 | Ga0123356_10229320 | 3300010049 | Bacteria | 1920 |
| 229 | Ga0123353_10101660 | 3300010167 | Bacteria | 4634 |
| 230 | Ga0123353_10238154 | 3300010167 | Bacteria | 2830 |
| 231 | Ga0466715_070716 | 3300042616 | Bacteria | 51142 |
| 232 | Ga0466715_451235 | 3300042616 | Bacteria | 8607 |
| 233 | Ga0466726_120494 | 3300042619 | Bacteria | 3198 |
| 234 | Ga0466726_184144 | 3300042619 | Bacteria | 5033 |
| 235 | Ga0466729_113418 | 3300042621 | Bacteria | 6442 |
| 236 | Ga0466729_158295 | 3300042621 | Bacteria | 11284 |
| 237 | Ga0466701_020037 | 3300042598 | Bacteria | 2851 |
| 238 | Ga0466701_057420 | 3300042598 | Bacteria | 17371 |
| 239 | Ga0466706_005029 | 3300042599 | Bacteria | 45009 |
| 240 | Ga0466706_106916 | 3300042599 | Bacteria | 12413 |
| 241 | Ga0466707_051962 | 3300042601 | Bacteria | 2429 |
| 242 | Ga0466707_370239 | 3300042601 | Bacteria | 3308 |
| 243 | Ga0466713_017471 | 3300042602 | Bacteria | 17916 |
| 244 | Ga0466713_043321 | 3300042602 | Bacteria | 21588 |
| 245 | Ga0466714_132771 | 3300042603 | Bacteria | 10274 |
| 246 | Ga0466714_135157 | 3300042603 | Bacteria | 3782 |
| 247 | Ga0466714_170207 | 3300042603 | Bacteria | 2836 |
| 248 | Ga0466716_080142 | 3300042605 | Bacteria | 10084 |
| 249 | Ga0466716_128873 | 3300042605 | Bacteria | 20808 |
| 250 | Ga0466719_499915 | 3300042606 | Bacteria | 9533 |
| 251 | Ga0466722_177390 | 3300042609 | Bacteria | 11360 |
| 252 | Ga0466722_208212 | 3300042609 | Bacteria | 8673 |
| 253 | Ga0466698_457661 | 3300042610 | Bacteria | 4622 |
| 254 | IMNBL1DRAFT_c0000010 | 3300000062 | Bacteria | 201282 |
| 255 | JGI24702J35022_10001319 | 3300002462 | Bacteria | 15423 |
| 256 | Ga0068305_10236912 | 3300005083 | Bacteria | 3667 |
| 257 | Ga0103265_1000086 | 3300007068 | Bacteria | 18456 |
| 258 | Ga0104019_1001056 | 3300007150 | Bacteria | 26163 |
| 259 | Ga0466735_051776 | 3300042624 | Bacteria | 31328 |
| 260 | Ga0466735_134167 | 3300042624 | Bacteria | 7096 |
| 261 | Ga0466703_159360 | 3300042636 | Bacteria | 14265 |
| 262 | Ga0466704_167118 | 3300042643 | Bacteria | 22514 |
| 263 | Ga0466704_322592 | 3300042643 | Bacteria | 12055 |
| 264 | Ga0466709_219154 | 3300042648 | Bacteria | 176728 |
| 265 | Ga0466708_254922 | 3300042652 | Bacteria | 84207 |
| 266 | Ga0466727_177809 | 3300042655 | Bacteria | 7604 |
| 267 | Ga0466705_250325 | 3300042612 | Unclassified | 5515 |
| 268 | Ga0466732_196541 | 3300042656 | Bacteria | 122148 |
| 269 | Ga0466733_053267 | 3300042659 | Bacteria | 6326 |
| 270 | Ga0160469_100036 | 3300012824 | Bacteria | 248494 |
| 271 | Ga0160447_100006 | 3300012849 | Bacteria | 523520 |
| 272 | Ga0157631_118547 | 3300013007 | Bacteria | 2469 |
| 273 | Ga0466690_158270 | 3300042590 | Bacteria | 5828 |
| 274 | Ga0466690_223492 | 3300042590 | Bacteria | 14225 |
| 275 | Ga0466690_374112 | 3300042590 | Bacteria | 9726 |
| 276 | Ga0466691_004508 | 3300042593 | Bacteria | 44771 |
| 277 | Ga0466691_119293 | 3300042593 | Bacteria | 5983 |
| 278 | Ga0466696_297494 | 3300042596 | Bacteria | 8088 |
| 279 | Ga0466696_300520 | 3300042596 | Bacteria | 26372 |
| 280 | Ga0466701_006196 | 3300042598 | Bacteria | 20310 |
| 281 | Ga0466701_010742 | 3300042598 | Bacteria | 44203 |
| 282 | Ga0123355_10026567 | 3300009826 | Bacteria | 9341 |
| 283 | Ga0123353_10002109 | 3300010167 | Bacteria | 24588 |
| 284 | Ga0123353_10023080 | 3300010167 | Bacteria | 9408 |
| 285 | Ga0123353_10144921 | 3300010167 | Bacteria | 3799 |
| 286 | Ga0123353_10351126 | 3300010167 | Bacteria | 2222 |
| 287 | Ga0123353_10629594 | 3300010167 | Bacteria | 1525 |
| 288 | Ga0466710_092129 | 3300042613 | Bacteria | 2075 |
| 289 | Ga0466710_351925 | 3300042613 | Bacteria | 5107 |
| 290 | Ga0466711_073420 | 3300042615 | Bacteria | 7522 |
| 291 | Ga0466711_303983 | 3300042615 | Bacteria | 2309 |
| 292 | Ga0466711_362979 | 3300042615 | Bacteria | 4935 |
| 293 | Ga0466715_190543 | 3300042616 | Bacteria | 10634 |
| 294 | Ga0466726_426171 | 3300042619 | Bacteria | 4874 |
| 295 | Ga0466726_435009 | 3300042619 | Bacteria | 10596 |
| 296 | Ga0466728_171931 | 3300042620 | Bacteria | 11526 |
| 297 | Ga0466728_412465 | 3300042620 | Bacteria | 16221 |
| 298 | Ga0466706_045671 | 3300042599 | Bacteria | 4996 |
| 299 | Ga0466706_049287 | 3300042599 | Bacteria | 7979 |
| 300 | Ga0466706_109175 | 3300042599 | Bacteria | 2343 |
| 301 | Ga0466706_165119 | 3300042599 | Bacteria | 66110 |
| 302 | Ga0466706_174920 | 3300042599 | Bacteria | 12699 |
| 303 | Ga0466707_113516 | 3300042601 | Bacteria | 14148 |
| 304 | Ga0466713_059345 | 3300042602 | Bacteria | 29151 |
| 305 | Ga0466714_022595 | 3300042603 | Bacteria | 225972 |
| 306 | Ga0466717_209710 | 3300042604 | Bacteria | 1790 |
| 307 | Ga0466716_494388 | 3300042605 | Bacteria | 18314 |
| 308 | Ga0466722_079151 | 3300042609 | Bacteria | 34331 |
| 309 | Ga0466722_176003 | 3300042609 | Bacteria | 44911 |
| 310 | IMNBL1DRAFT_c0000858 | 3300000062 | Bacteria | 23824 |
| 311 | HBC_ctgsDRAFT_1000022 | 3300000333 | Bacteria | 39906 |
| 312 | JGI24702J35022_10005927 | 3300002462 | Bacteria | 7100 |
| 313 | JGI24699J35502_11133924 | 3300002509 | Bacteria | 19657 |
| 314 | JGI24696J40584_12952313 | 3300002834 | Bacteria | 2332 |
| 315 | JGI24696J40584_12960662 | 3300002834 | Bacteria | 7949 |
| 316 | Ga0068305_10090368 | 3300005083 | Bacteria | 1525 |
| 317 | Ga0072941_1280323 | 3300005201 | Bacteria | 1804 |
| 318 | Ga0104041_1000258 | 3300007106 | Bacteria | 3438 |
| 319 | Ga0103264_1000027 | 3300007188 | Bacteria | 89570 |
| 320 | Ga0466731_100441 | 3300042622 | Bacteria | 3231 |
| 321 | Ga0466735_153745 | 3300042624 | Bacteria | 2497 |
| 322 | Ga0466703_350126 | 3300042636 | Bacteria | 10804 |
| 323 | Ga0466703_419319 | 3300042636 | Bacteria | 1536 |
| 324 | Ga0466709_321544 | 3300042648 | Bacteria | 8248 |
| 325 | Ga0466724_04994 | 3300042649 | Bacteria | 3493 |
| 326 | Ga0466724_07109 | 3300042649 | Bacteria | 285871 |
| 327 | Ga0466708_082910 | 3300042652 | Bacteria | 14844 |
| 328 | Ga0466708_465623 | 3300042652 | Bacteria | 1804 |
| 329 | Ga0466725_177811 | 3300042654 | Bacteria | 17602 |
| 330 | Ga0466727_007290 | 3300042655 | Bacteria | 25400 |
| 331 | Ga0466727_068887 | 3300042655 | Bacteria | 9901 |
| 332 | Ga0466697_076090 | 3300042611 | Bacteria | 3004 |
| 333 | Ga0466697_281577 | 3300042611 | Bacteria | 3227 |
| 334 | Ga0466705_138278 | 3300042612 | Bacteria | 11959 |
| 335 | Ga0466732_006496 | 3300042656 | Bacteria | 1373 |
| 336 | Ga0466733_002874 | 3300042659 | Bacteria | 25958 |
| 337 | Ga0466733_102832 | 3300042659 | Bacteria | 13681 |
| 338 | Ga0160470_100326 | 3300012813 | Bacteria | 26423 |
| 339 | Ga0160453_100226 | 3300012814 | Bacteria | 54682 |
| 340 | Ga0160469_101624 | 3300012824 | Bacteria | 5511 |
| 341 | Ga0160460_100002 | 3300012845 | Bacteria | 833437 |
| 342 | Ga0466690_046717 | 3300042590 | Bacteria | 12327 |
| 343 | Ga0466690_066852 | 3300042590 | Bacteria | 6896 |
| 344 | Ga0466693_261506 | 3300042592 | Bacteria | 1431 |
| 345 | Ga0466691_023060 | 3300042593 | Bacteria | 9157 |
| 346 | Ga0466691_048450 | 3300042593 | Bacteria | 11729 |
| 347 | Ga0466691_088234 | 3300042593 | Bacteria | 133743 |
| 348 | Ga0466695_143425 | 3300042595 | Bacteria | 2889 |
| 349 | Ga0466696_454840 | 3300042596 | Bacteria | 6208 |
| 350 | Ga0123357_10053881 | 3300009784 | Bacteria | 5425 |
| 351 | Ga0123353_10012146 | 3300010167 | Bacteria | 12209 |
| 352 | Ga0466705_528792 | 3300042612 | Bacteria | 10373 |
| 353 | Ga0466711_452375 | 3300042615 | Bacteria | 20683 |
| 354 | Ga0466715_017366 | 3300042616 | Bacteria | 15637 |
| 355 | Ga0466715_440141 | 3300042616 | Bacteria | 22634 |
| 356 | Ga0466726_064138 | 3300042619 | Bacteria | 29723 |
| 357 | Ga0466726_123280 | 3300042619 | Bacteria | 2737 |
| 358 | Ga0466728_046729 | 3300042620 | Bacteria | 48709 |
| 359 | Ga0466728_134106 | 3300042620 | Bacteria | 2821 |
| 360 | Ga0466701_026555 | 3300042598 | Bacteria | 165892 |
| 361 | Ga0466701_060188 | 3300042598 | Bacteria | 2001 |
| 362 | Ga0466706_057997 | 3300042599 | Bacteria | 77163 |
| 363 | Ga0466706_138293 | 3300042599 | Bacteria | 60619 |
| 364 | Ga0466706_185520 | 3300042599 | Bacteria | 28937 |
| 365 | Ga0466707_106928 | 3300042601 | Bacteria | 18647 |
| 366 | Ga0466707_271493 | 3300042601 | Bacteria | 2282 |
| 367 | Ga0466707_413318 | 3300042601 | Bacteria | 8671 |
| 368 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 369 | Ga0466713_019529 | 3300042602 | Bacteria | 8505 |
| 370 | Ga0466713_069027 | 3300042602 | Bacteria | 25576 |
| 371 | Ga0466713_137531 | 3300042602 | Bacteria | 1379 |
| 372 | Ga0466714_044083 | 3300042603 | Bacteria | 3485 |
| 373 | Ga0466714_054733 | 3300042603 | Bacteria | 12051 |
| 374 | Ga0466719_092173 | 3300042606 | Bacteria | 9234 |
| 375 | Ga0466722_100654 | 3300042609 | Bacteria | 6592 |
| 376 | 2227172479 | 2225789004 | Bacteria | 8175 |
| 377 | IMNBL1DRAFT_c0002897 | 3300000062 | Bacteria | 11491 |
| 378 | IMNBL1DRAFT_c0007251 | 3300000062 | Bacteria | 5870 |
| 379 | IMNBL1DRAFT_c0012960 | 3300000062 | Bacteria | 3774 |
| 380 | JGI24702J35022_10000519 | 3300002462 | Bacteria | 23307 |
| 381 | JGI24702J35022_10014829 | 3300002462 | Bacteria | 4294 |
| 382 | JGI24705J35276_12238563 | 3300002504 | Bacteria | 26858 |
| 383 | Ga0068305_10031783 | 3300005083 | Bacteria | 6880 |
| 384 | Ga0074308_1018736 | 3300005307 | Bacteria | 1880 |
| 385 | Ga0074302_1028749 | 3300005316 | Bacteria | 1922 |
| 386 | Ga0103265_1000002 | 3300007068 | Bacteria | 139087 |
| 387 | Ga0102735_1000288 | 3300007080 | Bacteria | 11842 |
| 388 | Ga0104045_1003730 | 3300007085 | Unclassified | 4539 |
| 389 | Ga0104019_1030715 | 3300007150 | Bacteria | 4229 |
| 390 | Ga0104050_1026351 | 3300007153 | Unclassified | 4599 |
| 391 | Ga0103268_1000172 | 3300007192 | Bacteria | 21394 |
| 392 | Ga0466731_052661 | 3300042622 | Bacteria | 1717 |
| 393 | Ga0466735_125367 | 3300042624 | Bacteria | 2030 |
| 394 | Ga0466703_121313 | 3300042636 | Bacteria | 3365 |
| 395 | Ga0466704_452987 | 3300042643 | Bacteria | 2156 |
| 396 | Ga0466709_063304 | 3300042648 | Bacteria | 43232 |
| 397 | Ga0466709_084097 | 3300042648 | Bacteria | 147707 |
| 398 | Ga0466709_223261 | 3300042648 | Bacteria | 39132 |
| 399 | Ga0466708_084318 | 3300042652 | Bacteria | 37522 |
| 400 | Ga0466708_427674 | 3300042652 | Bacteria | 44564 |
| 401 | Ga0466733_031780 | 3300042659 | Bacteria | 11540 |
| 402 | Ga0466733_113997 | 3300042659 | Bacteria | 7785 |
| 403 | Ga0160455_100706 | 3300012837 | Bacteria | 13738 |
| 404 | Ga0160443_100066 | 3300012848 | Bacteria | 204480 |
| 405 | Ga0466656_097190 | 3300042550 | Bacteria | 10269 |
| 406 | Ga0466692_176669 | 3300042591 | Bacteria | 77723 |
| 407 | Ga0466696_025835 | 3300042596 | Bacteria | 3238 |
| 408 | Ga0466696_079078 | 3300042596 | Bacteria | 5051 |
| 409 | Ga0123353_10003111 | 3300010167 | Bacteria | 20816 |
| 410 | Ga0123353_10102139 | 3300010167 | Bacteria | 4622 |
| 411 | Ga0160454_100001 | 3300012798 | Bacteria | 780029 |
| 412 | Ga0466710_056102 | 3300042613 | Bacteria | 1492 |
| 413 | Ga0466710_073307 | 3300042613 | Bacteria | 5353 |
| 414 | Ga0466711_031881 | 3300042615 | Bacteria | 12261 |
| 415 | Ga0466711_044318 | 3300042615 | Bacteria | 25037 |
| 416 | Ga0466711_055645 | 3300042615 | Bacteria | 11730 |
| 417 | Ga0466711_393542 | 3300042615 | Bacteria | 13884 |
| 418 | Ga0466715_023239 | 3300042616 | Bacteria | 8258 |
| 419 | Ga0466715_057517 | 3300042616 | Unclassified | 16762 |
| 420 | Ga0466715_059464 | 3300042616 | Bacteria | 16926 |
| 421 | Ga0466726_222056 | 3300042619 | Bacteria | 1967 |
| 422 | Ga0466706_025987 | 3300042599 | Bacteria | 23569 |
| 423 | Ga0466706_055922 | 3300042599 | Bacteria | 56716 |
| 424 | Ga0466707_083388 | 3300042601 | Bacteria | 24803 |
| 425 | Ga0466707_235520 | 3300042601 | Bacteria | 14514 |
| 426 | Ga0466707_307446 | 3300042601 | Bacteria | 3041 |
| 427 | Ga0466707_394913 | 3300042601 | Bacteria | 2037 |
| 428 | Ga0466713_053556 | 3300042602 | Bacteria | 5833 |
| 429 | Ga0466713_059113 | 3300042602 | Bacteria | 26058 |
| 430 | Ga0466713_149587 | 3300042602 | Bacteria | 21967 |
| 431 | Ga0466714_009990 | 3300042603 | Bacteria | 1932 |
| 432 | Ga0466714_013900 | 3300042603 | Bacteria | 2608 |
| 433 | Ga0466714_110980 | 3300042603 | Bacteria | 46839 |
| 434 | Ga0466714_112702 | 3300042603 | Bacteria | 26125 |
| 435 | Ga0466716_432153 | 3300042605 | Bacteria | 3099 |
| 436 | Ga0466719_225658 | 3300042606 | Bacteria | 39861 |
| 437 | Ga0466719_507473 | 3300042606 | Bacteria | 3589 |
| 438 | Ga0466722_143956 | 3300042609 | Bacteria | 4759 |
| 439 | Ga0466698_445932 | 3300042610 | Bacteria | 1413 |
| 440 | 2227469083 | 2225789004 | Bacteria | 23805 |
| 441 | IMNBL1DRAFT_c0011477 | 3300000062 | Bacteria | 4134 |
| 442 | Ga0068305_10041748 | 3300005083 | Bacteria | 43319 |
| 443 | Ga0103267_1000020 | 3300007190 | Bacteria | 55669 |
| 444 | Ga0103267_1000184 | 3300007190 | Bacteria | 24517 |
| 445 | Ga0466729_229041 | 3300042621 | Bacteria | 8039 |
| 446 | Ga0466735_171020 | 3300042624 | Bacteria | 2568 |
| 447 | Ga0466703_136731 | 3300042636 | Bacteria | 10334 |
| 448 | Ga0466703_315308 | 3300042636 | Bacteria | 4313 |
| 449 | Ga0466704_211333 | 3300042643 | Bacteria | 24735 |
| 450 | Ga0466704_247280 | 3300042643 | Bacteria | 18729 |
| 451 | Ga0466704_478336 | 3300042643 | Bacteria | 4242 |
| 452 | Ga0466704_481288 | 3300042643 | Bacteria | 19956 |
| 453 | Ga0466709_011196 | 3300042648 | Bacteria | 9771 |
| 454 | Ga0466724_52664 | 3300042649 | Bacteria | 5240 |
| 455 | Ga0466708_232266 | 3300042652 | Bacteria | 65416 |
| 456 | Ga0466725_371448 | 3300042654 | Bacteria | 1669 |
| 457 | Ga0466727_188876 | 3300042655 | Bacteria | 4801 |
| 458 | Ga0466733_045093 | 3300042659 | Bacteria | 35557 |
| 459 | Ga0466657_311782 | 3300042582 | Unclassified | 3595 |
| 460 | Ga0466690_058188 | 3300042590 | Bacteria | 6751 |
| 461 | Ga0466693_358540 | 3300042592 | Bacteria | 2520 |
| 462 | Ga0466691_024990 | 3300042593 | Bacteria | 118277 |
| 463 | Ga0466691_030865 | 3300042593 | Bacteria | 23146 |
| 464 | Ga0466695_178590 | 3300042595 | Bacteria | 10907 |
| 465 | Ga0466696_139083 | 3300042596 | Bacteria | 9995 |
| 466 | Ga0466696_319002 | 3300042596 | Bacteria | 14830 |
| 467 | Ga0123357_10033091 | 3300009784 | Bacteria | 7023 |
| 468 | Ga0123355_10000211 | 3300009826 | Bacteria | 73196 |
| 469 | Ga0123353_10009768 | 3300010167 | Bacteria | 13291 |
| 470 | Ga0123353_10058551 | 3300010167 | Bacteria | 6174 |
| 471 | Ga0123353_10093379 | 3300010167 | Bacteria | 4848 |
| 472 | Ga0123354_10002886 | 3300010882 | Bacteria | 23295 |
| 473 | Ga0123354_10097223 | 3300010882 | Bacteria | 4014 |
| 474 | Ga0466705_435478 | 3300042612 | Bacteria | 9537 |
| 475 | Ga0466712_314630 | 3300042614 | Bacteria | 2441 |
| 476 | Ga0466715_079603 | 3300042616 | Bacteria | 222305 |
| 477 | Ga0466715_231386 | 3300042616 | Bacteria | 80319 |
| 478 | Ga0466715_503926 | 3300042616 | Bacteria | 1520 |
| 479 | Ga0466723_164176 | 3300042618 | Bacteria | 29831 |
| 480 | Ga0466723_369313 | 3300042618 | Bacteria | 13885 |
| 481 | Ga0466726_293828 | 3300042619 | Bacteria | 11233 |
| 482 | Ga0466726_336567 | 3300042619 | Bacteria | 3842 |
| 483 | Ga0466728_431241 | 3300042620 | Bacteria | 10879 |
| 484 | Ga0466729_039981 | 3300042621 | Bacteria | 13672 |
| 485 | Ga0466729_081093 | 3300042621 | Bacteria | 2623 |
| 486 | Ga0466701_049067 | 3300042598 | Bacteria | 164552 |
| 487 | Ga0466701_093860 | 3300042598 | Unclassified | 2936 |
| 488 | Ga0466706_067854 | 3300042599 | Bacteria | 18717 |
| 489 | Ga0466706_079195 | 3300042599 | Bacteria | 25173 |
| 490 | Ga0466706_108817 | 3300042599 | Bacteria | 19796 |
| 491 | Ga0466706_112276 | 3300042599 | Bacteria | 13729 |
| 492 | Ga0466713_019678 | 3300042602 | Bacteria | 71467 |
| 493 | Ga0466713_025353 | 3300042602 | Bacteria | 4089 |
| 494 | Ga0466713_099393 | 3300042602 | Bacteria | 23321 |
| 495 | Ga0466713_102420 | 3300042602 | Bacteria | 24303 |
| 496 | Ga0466714_028281 | 3300042603 | Bacteria | 3156 |
| 497 | Ga0466714_100882 | 3300042603 | Unclassified | 8673 |
| 498 | Ga0466714_107608 | 3300042603 | Bacteria | 5562 |
| 499 | Ga0466716_267297 | 3300042605 | Unclassified | 3404 |
| 500 | Ga0466722_018486 | 3300042609 | Bacteria | 15436 |
| 501 | Ga0466722_022736 | 3300042609 | Bacteria | 1623 |
| 502 | 2227302995 | 2225789004 | Bacteria | 29874 |
| 503 | IMNBL1DRAFT_c0000936 | 3300000062 | Bacteria | 22561 |
| 504 | IMNBL1DRAFT_c0012062 | 3300000062 | Bacteria | 3981 |
| 505 | IMNBL1DRAFT_c0012726 | 3300000062 | Bacteria | 3828 |
| 506 | JGI24702J35022_10022068 | 3300002462 | Bacteria | 3450 |
| 507 | JGI24702J35022_10026547 | 3300002462 | Bacteria | 3119 |
| 508 | JGI24702J35022_10030573 | 3300002462 | Bacteria | 2889 |
| 509 | JGI24702J35022_10060941 | 3300002462 | Bacteria | 2018 |
| 510 | CVPL010W_10001112 | 3300002931 | Bacteria | 47286 |
| 511 | CVPL010W_10001300 | 3300002931 | Bacteria | 54229 |
| 512 | Ga0068305_10720159 | 3300005083 | Bacteria | 1426 |
| 513 | Ga0072941_1255252 | 3300005201 | Bacteria | 3725 |
| 514 | Ga0104045_1001432 | 3300007085 | Bacteria | 2499 |
| 515 | Ga0104045_1019232 | 3300007085 | Unclassified | 11070 |
| 516 | Ga0104048_1022594 | 3300007143 | Unclassified | 3219 |
| 517 | Ga0466729_243763 | 3300042621 | Bacteria | 27150 |
| 518 | Ga0466703_203185 | 3300042636 | Bacteria | 2379 |
| 519 | Ga0466704_357167 | 3300042643 | Bacteria | 10119 |
| 520 | Ga0466724_21689 | 3300042649 | Unclassified | 29154 |
| 521 | Ga0466727_012841 | 3300042655 | Unclassified | 13574 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01926 | GO:0005525 | GTP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.