Protein Family IF06593
Metagenome
Metatranscriptome
Isolate
387
Members
85
Samples
361
Scaffolds
209.32
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_480307|Ga0466719_480307_1412_2134
- Length
- 240 aa
- Sequence
- LLLRVKIGKLWGKGFSKNFGDPFLLKEYPMKLIFLGPPGAGKGTVAVRAAEMLTLPHISTGAIFRSAIAAESPLGLKVKAIIEAGKLVDDETTIALVRERLARDDAQRGYILDGFPRTIPQAEALAGFSVVDKAVNFDLPDAAVLERLGGRRVCRKCGANYHTVFNRPKKEGVCDVCGGEIYTRDDDRQEAVQKRLEVYREQTAPLIDYYREKGLLTDVDARPPVDGVVANFKKALGITL
Sample Types
Isolate
6.7%
Metagenome
93.0%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.8%
Unclassified
34.1%
Kalotermitidae
17.1%
Rhinotermitidae
4.9%
Termopsidae
3.7%
Blaberidae
1.2%
Hodotermitidae
1.2%
Taxonomy
Archaea
1
Bacteria
344
Eukaryota
0
Viruses
0
Unclassified
42
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 2 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 3 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 4 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 5 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 6 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 7 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 8 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 9 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 10 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 11 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 12 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 25 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 32 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 33 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 37 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 38 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 45 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 46 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 47 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 53 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 54 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 55 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 56 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 57 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 60 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 64 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 65 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 66 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 67 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 68 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 69 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 70 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 71 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 72 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 73 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 74 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 75 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 76 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 77 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 78 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 79 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 80 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 81 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 82 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 83 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 84 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 85 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | AustNasuHG_c1030667 | 3300000089 | Unclassified | 1542 |
| 2 | AustNasuHG_c1039995 | 3300000089 | Unclassified | 1154 |
| 3 | JGI24698J34947_10006064 | 3300002449 | Bacteria | 6634 |
| 4 | JGI24698J34947_10021439 | 3300002449 | Bacteria | 3475 |
| 5 | JGI24695J34938_10006986 | 3300002450 | Bacteria | 6691 |
| 6 | JGI24695J34938_10014756 | 3300002450 | Bacteria | 4033 |
| 7 | JGI24695J34938_10019621 | 3300002450 | Bacteria | 3346 |
| 8 | JGI24695J34938_10077083 | 3300002450 | Bacteria | 1383 |
| 9 | JGI24702J35022_10010811 | 3300002462 | Bacteria | 5093 |
| 10 | Ga0072940_1031449 | 3300005200 | Bacteria | 6306 |
| 11 | Ga0072941_1228443 | 3300005201 | Bacteria | 2329 |
| 12 | Ga0466712_006194 | 3300042614 | Bacteria | 2552 |
| 13 | Ga0466712_066339 | 3300042614 | Bacteria | 20042 |
| 14 | Ga0466711_014343 | 3300042615 | Bacteria | 4453 |
| 15 | Ga0466715_069467 | 3300042616 | Bacteria | 2203 |
| 16 | Ga0466715_155062 | 3300042616 | Bacteria | 14063 |
| 17 | Ga0466715_474258 | 3300042616 | Bacteria | 4555 |
| 18 | Ga0466718_122261 | 3300042617 | Unclassified | 1843 |
| 19 | Ga0466718_156706 | 3300042617 | Bacteria | 1667 |
| 20 | Ga0466718_163444 | 3300042617 | Unclassified | 1102 |
| 21 | Ga0466726_183729 | 3300042619 | Bacteria | 1761 |
| 22 | Ga0466726_298603 | 3300042619 | Bacteria | 1019 |
| 23 | Ga0466700_053364 | 3300042600 | Bacteria | 2097 |
| 24 | Ga0466700_245186 | 3300042600 | Bacteria | 1795 |
| 25 | Ga0466717_161855 | 3300042604 | Bacteria | 1261 |
| 26 | Ga0466717_254175 | 3300042604 | Bacteria | 1379 |
| 27 | Ga0466719_220351 | 3300042606 | Bacteria | 8460 |
| 28 | Ga0466720_036409 | 3300042607 | Bacteria | 10791 |
| 29 | Ga0264413_101390 | 3300024493 | Bacteria | 26329 |
| 30 | Ga0264413_109620 | 3300024493 | Bacteria | 5118 |
| 31 | Ga0264413_110948 | 3300024493 | Bacteria | 3043 |
| 32 | Ga0466692_149528 | 3300042591 | Bacteria | 25005 |
| 33 | Ga0466693_297058 | 3300042592 | Bacteria | 2669 |
| 34 | Ga0466699_032274 | 3300042597 | Bacteria | 1123 |
| 35 | Ga0466699_036307 | 3300042597 | Bacteria | 1019 |
| 36 | Ga0123355_10025493 | 3300009826 | Bacteria | 9519 |
| 37 | Ga0123356_10133302 | 3300010049 | Bacteria | 2438 |
| 38 | Ga0123356_10293730 | 3300010049 | Bacteria | 1727 |
| 39 | Ga0123353_10569448 | 3300010167 | Bacteria | 1628 |
| 40 | Ga0466705_208241 | 3300042612 | Bacteria | 3365 |
| 41 | Ga0466705_217764 | 3300042612 | Bacteria | 1137 |
| 42 | Ga0466702_163887 | 3300042635 | Bacteria | 5897 |
| 43 | Ga0466703_423744 | 3300042636 | Bacteria | 16343 |
| 44 | Ga0466704_272900 | 3300042643 | Bacteria | 2469 |
| 45 | Ga0466727_266391 | 3300042655 | Bacteria | 17904 |
| 46 | JGI24698J34947_10015638 | 3300002449 | Bacteria | 4129 |
| 47 | JGI24698J34947_10015689 | 3300002449 | Bacteria | 4120 |
| 48 | JGI24698J34947_10101341 | 3300002449 | Bacteria | 1294 |
| 49 | JGI24698J34947_10178876 | 3300002449 | Bacteria | 850 |
| 50 | JGI24695J34938_10000575 | 3300002450 | Bacteria | 35379 |
| 51 | JGI24695J34938_10000752 | 3300002450 | Bacteria | 30427 |
| 52 | JGI24695J34938_10008139 | 3300002450 | Bacteria | 6030 |
| 53 | JGI24695J34938_10019181 | 3300002450 | Unclassified | 3397 |
| 54 | JGI24702J35022_10238220 | 3300002462 | Unclassified | 1055 |
| 55 | Ga0072941_1026080 | 3300005201 | Unclassified | 1772 |
| 56 | Ga0074263_117657 | 3300005485 | Bacteria | 1935 |
| 57 | Ga0466732_294859 | 3300042656 | Bacteria | 1958 |
| 58 | Ga0466733_078307 | 3300042659 | Bacteria | 3111 |
| 59 | Ga0466712_078232 | 3300042614 | Bacteria | 13492 |
| 60 | Ga0466712_194539 | 3300042614 | Bacteria | 3973 |
| 61 | Ga0466711_473404 | 3300042615 | Bacteria | 3477 |
| 62 | Ga0466718_040908 | 3300042617 | Unclassified | 2757 |
| 63 | Ga0466718_086638 | 3300042617 | Bacteria | 1387 |
| 64 | Ga0466718_146904 | 3300042617 | Unclassified | 1601 |
| 65 | Ga0466718_157853 | 3300042617 | Unclassified | 1134 |
| 66 | Ga0466723_340850 | 3300042618 | Bacteria | 7615 |
| 67 | Ga0466726_079157 | 3300042619 | Bacteria | 4411 |
| 68 | Ga0466726_457858 | 3300042619 | Bacteria | 1912 |
| 69 | Ga0466716_266000 | 3300042605 | Bacteria | 10763 |
| 70 | Ga0466719_480307 | 3300042606 | Bacteria | 2407 |
| 71 | Ga0466720_046265 | 3300042607 | Bacteria | 10532 |
| 72 | Ga0466720_112191 | 3300042607 | Archaea | 3382 |
| 73 | Ga0466722_018943 | 3300042609 | Bacteria | 15115 |
| 74 | Ga0466722_022786 | 3300042609 | Bacteria | 8214 |
| 75 | Ga0466722_256741 | 3300042609 | Unclassified | 1224 |
| 76 | Ga0264413_109619 | 3300024493 | Bacteria | 7218 |
| 77 | Ga0415639_014971 | 3300038395 | Bacteria | 8097 |
| 78 | Ga0415639_079814 | 3300038395 | Bacteria | 2971 |
| 79 | Ga0415639_091982 | 3300038395 | Bacteria | 7123 |
| 80 | Ga0466690_034725 | 3300042590 | Bacteria | 3109 |
| 81 | Ga0466692_096205 | 3300042591 | Bacteria | 8078 |
| 82 | Ga0466692_190743 | 3300042591 | Bacteria | 1570 |
| 83 | Ga0466691_124833 | 3300042593 | Unclassified | 2783 |
| 84 | Ga0466694_142454 | 3300042594 | Bacteria | 2460 |
| 85 | Ga0466694_149958 | 3300042594 | Bacteria | 3061 |
| 86 | Ga0466694_249377 | 3300042594 | Bacteria | 1000 |
| 87 | Ga0466695_246433 | 3300042595 | Bacteria | 2679 |
| 88 | Ga0466699_135266 | 3300042597 | Bacteria | 4296 |
| 89 | Ga0466699_173327 | 3300042597 | Bacteria | 1073 |
| 90 | Ga0466699_383808 | 3300042597 | Bacteria | 60708 |
| 91 | Ga0123356_10014829 | 3300010049 | Bacteria | 7483 |
| 92 | Ga0123356_10015730 | 3300010049 | Bacteria | 7241 |
| 93 | Ga0123356_10347751 | 3300010049 | Bacteria | 1605 |
| 94 | Ga0123353_10683294 | 3300010167 | Bacteria | 1445 |
| 95 | Ga0123353_11161517 | 3300010167 | Bacteria | 1018 |
| 96 | Ga0466705_026607 | 3300042612 | Bacteria | 47022 |
| 97 | Ga0466731_228672 | 3300042622 | Bacteria | 1466 |
| 98 | Ga0466735_186353 | 3300042624 | Bacteria | 1454 |
| 99 | Ga0466702_094034 | 3300042635 | Bacteria | 3594 |
| 100 | Ga0466703_067186 | 3300042636 | Bacteria | 6278 |
| 101 | Ga0466704_454336 | 3300042643 | Bacteria | 2477 |
| 102 | Ga0466709_291476 | 3300042648 | Bacteria | 4707 |
| 103 | Ga0466708_441999 | 3300042652 | Bacteria | 2944 |
| 104 | Ga0466727_121120 | 3300042655 | Bacteria | 3481 |
| 105 | Ga0466727_259572 | 3300042655 | Bacteria | 1609 |
| 106 | JGI24698J34947_10190932 | 3300002449 | Unclassified | 810 |
| 107 | JGI24695J34938_10001169 | 3300002450 | Bacteria | 23327 |
| 108 | JGI24695J34938_10002070 | 3300002450 | Bacteria | 15742 |
| 109 | JGI24695J34938_10008975 | 3300002450 | Bacteria | 5626 |
| 110 | JGI24695J34938_10077109 | 3300002450 | Bacteria | 1383 |
| 111 | JGI24697J35500_11264060 | 3300002507 | Unclassified | 3267 |
| 112 | JGI24699J35502_11102894 | 3300002509 | Unclassified | 2417 |
| 113 | Ga0068305_10000321 | 3300005083 | Bacteria | 25712 |
| 114 | Ga0068305_10002657 | 3300005083 | Bacteria | 3665 |
| 115 | Ga0068305_10066994 | 3300005083 | Bacteria | 10185 |
| 116 | Ga0072941_1015180 | 3300005201 | Bacteria | 10506 |
| 117 | Ga0466732_220990 | 3300042656 | Bacteria | 1414 |
| 118 | Ga0466732_404989 | 3300042656 | Unclassified | 1086 |
| 119 | Ga0466733_120098 | 3300042659 | Bacteria | 2562 |
| 120 | Ga0466733_152527 | 3300042659 | Bacteria | 1982 |
| 121 | Ga0466705_430014 | 3300042612 | Bacteria | 1304 |
| 122 | Ga0466712_095233 | 3300042614 | Unclassified | 1025 |
| 123 | Ga0466715_278161 | 3300042616 | Bacteria | 20583 |
| 124 | Ga0466726_433208 | 3300042619 | Bacteria | 1016 |
| 125 | Ga0466706_167304 | 3300042599 | Bacteria | 2011 |
| 126 | Ga0466700_209818 | 3300042600 | Bacteria | 1619 |
| 127 | Ga0466700_431045 | 3300042600 | Bacteria | 1592 |
| 128 | Ga0466707_347973 | 3300042601 | Bacteria | 1092 |
| 129 | Ga0466707_359636 | 3300042601 | Bacteria | 1177 |
| 130 | Ga0466716_007026 | 3300042605 | Bacteria | 2943 |
| 131 | Ga0466716_470674 | 3300042605 | Bacteria | 3553 |
| 132 | Ga0466719_543663 | 3300042606 | Bacteria | 6542 |
| 133 | Ga0466720_060318 | 3300042607 | Unclassified | 2415 |
| 134 | Ga0466722_027003 | 3300042609 | Bacteria | 25385 |
| 135 | Ga0466722_059218 | 3300042609 | Bacteria | 4707 |
| 136 | Ga0415639_159831 | 3300038395 | Bacteria | 1672 |
| 137 | Ga0466691_030468 | 3300042593 | Bacteria | 5105 |
| 138 | Ga0466691_037868 | 3300042593 | Bacteria | 3794 |
| 139 | Ga0466694_089903 | 3300042594 | Bacteria | 7004 |
| 140 | Ga0466694_129890 | 3300042594 | Bacteria | 1573 |
| 141 | Ga0123356_10031454 | 3300010049 | Bacteria | 4966 |
| 142 | Ga0123356_10046455 | 3300010049 | Bacteria | 4039 |
| 143 | Ga0123356_10377032 | 3300010049 | Bacteria | 1550 |
| 144 | Ga0123353_10236698 | 3300010167 | Bacteria | 2841 |
| 145 | Ga0466702_319395 | 3300042635 | Bacteria | 2100 |
| 146 | Ga0466704_562740 | 3300042643 | Bacteria | 1185 |
| 147 | Ga0466708_002827 | 3300042652 | Bacteria | 21249 |
| 148 | Ga0466727_213238 | 3300042655 | Bacteria | 1506 |
| 149 | AustNasuHG_c1007001 | 3300000089 | Bacteria | 4018 |
| 150 | AustNasuHG_c1029783 | 3300000089 | Unclassified | 1589 |
| 151 | AustNasuHG_c1047708 | 3300000089 | Unclassified | 951 |
| 152 | JGI24698J34947_10004411 | 3300002449 | Bacteria | 7662 |
| 153 | JGI24698J34947_10006640 | 3300002449 | Bacteria | 6354 |
| 154 | JGI24698J34947_10007757 | 3300002449 | Bacteria | 5897 |
| 155 | JGI24698J34947_10017294 | 3300002449 | Unclassified | 3909 |
| 156 | JGI24698J34947_10055952 | 3300002449 | Bacteria | 1963 |
| 157 | JGI24695J34938_10000071 | 3300002450 | Bacteria | 85834 |
| 158 | JGI24695J34938_10000130 | 3300002450 | Bacteria | 67854 |
| 159 | JGI24695J34938_10002610 | 3300002450 | Bacteria | 13557 |
| 160 | JGI24695J34938_10002879 | 3300002450 | Bacteria | 12540 |
| 161 | JGI24695J34938_10048117 | 3300002450 | Bacteria | 1880 |
| 162 | Ga0466712_139091 | 3300042614 | Bacteria | 2763 |
| 163 | Ga0466718_007886 | 3300042617 | Bacteria | 2523 |
| 164 | Ga0466718_020377 | 3300042617 | Unclassified | 13152 |
| 165 | Ga0466718_089511 | 3300042617 | Bacteria | 5375 |
| 166 | Ga0466718_169563 | 3300042617 | Bacteria | 1203 |
| 167 | Ga0466723_058149 | 3300042618 | Bacteria | 34327 |
| 168 | Ga0466723_214286 | 3300042618 | Bacteria | 3338 |
| 169 | Ga0466728_126245 | 3300042620 | Bacteria | 4299 |
| 170 | Ga0466719_091732 | 3300042606 | Bacteria | 18239 |
| 171 | Ga0466720_048079 | 3300042607 | Bacteria | 5489 |
| 172 | Ga0466720_058071 | 3300042607 | Bacteria | 29909 |
| 173 | Ga0466722_080684 | 3300042609 | Bacteria | 8326 |
| 174 | Ga0466722_092793 | 3300042609 | Bacteria | 6853 |
| 175 | Ga0466722_118716 | 3300042609 | Bacteria | 1197 |
| 176 | Ga0466722_150840 | 3300042609 | Bacteria | 2173 |
| 177 | Ga0466722_264345 | 3300042609 | Bacteria | 2618 |
| 178 | Ga0466694_257106 | 3300042594 | Bacteria | 40558 |
| 179 | Ga0466696_015946 | 3300042596 | Bacteria | 2529 |
| 180 | Ga0123357_10485732 | 3300009784 | Bacteria | 1039 |
| 181 | Ga0123356_10009356 | 3300010049 | Bacteria | 9678 |
| 182 | Ga0123356_10533355 | 3300010049 | Bacteria | 1333 |
| 183 | Ga0466705_015291 | 3300042612 | Bacteria | 23966 |
| 184 | Ga0466705_083070 | 3300042612 | Bacteria | 39024 |
| 185 | Ga0466735_214470 | 3300042624 | Unclassified | 1049 |
| 186 | Ga0466703_003340 | 3300042636 | Bacteria | 13925 |
| 187 | Ga0466703_059688 | 3300042636 | Bacteria | 8599 |
| 188 | Ga0466703_166182 | 3300042636 | Bacteria | 6376 |
| 189 | Ga0466708_185973 | 3300042652 | Bacteria | 10794 |
| 190 | FAAS_10007365 | 3300001880 | Bacteria | 998 |
| 191 | JGI24698J34947_10023428 | 3300002449 | Unclassified | 3304 |
| 192 | JGI24698J34947_10026468 | 3300002449 | Bacteria | 3082 |
| 193 | JGI24695J34938_10000177 | 3300002450 | Bacteria | 59454 |
| 194 | JGI24695J34938_10003467 | 3300002450 | Bacteria | 11001 |
| 195 | JGI24695J34938_10003589 | 3300002450 | Bacteria | 10679 |
| 196 | JGI24695J34938_10005573 | 3300002450 | Bacteria | 7807 |
| 197 | JGI24695J34938_10050172 | 3300002450 | Bacteria | 1831 |
| 198 | Ga0072941_1032147 | 3300005201 | Bacteria | 8113 |
| 199 | Ga0123357_10000140 | 3300009784 | Bacteria | 63300 |
| 200 | Ga0466732_063652 | 3300042656 | Bacteria | 1329 |
| 201 | Ga0466711_318451 | 3300042615 | Bacteria | 15242 |
| 202 | Ga0466715_211094 | 3300042616 | Bacteria | 9156 |
| 203 | Ga0466718_015162 | 3300042617 | Bacteria | 17755 |
| 204 | Ga0466723_010444 | 3300042618 | Bacteria | 8730 |
| 205 | Ga0466723_090951 | 3300042618 | Bacteria | 3595 |
| 206 | Ga0466723_187853 | 3300042618 | Bacteria | 5871 |
| 207 | Ga0466720_023030 | 3300042607 | Bacteria | 2364 |
| 208 | Ga0466720_142495 | 3300042607 | Unclassified | 1069 |
| 209 | Ga0466722_096500 | 3300042609 | Bacteria | 16350 |
| 210 | Ga0264413_110750 | 3300024493 | Bacteria | 7699 |
| 211 | Ga0264413_118592 | 3300024493 | Bacteria | 3069 |
| 212 | Ga0466692_009973 | 3300042591 | Bacteria | 16927 |
| 213 | Ga0466692_156168 | 3300042591 | Bacteria | 1686 |
| 214 | Ga0466693_049301 | 3300042592 | Bacteria | 70349 |
| 215 | Ga0466691_055946 | 3300042593 | Bacteria | 3972 |
| 216 | Ga0466694_030783 | 3300042594 | Bacteria | 2489 |
| 217 | Ga0466694_132195 | 3300042594 | Bacteria | 11309 |
| 218 | Ga0466694_401316 | 3300042594 | Bacteria | 3236 |
| 219 | Ga0466699_008607 | 3300042597 | Bacteria | 2676 |
| 220 | Ga0466699_324269 | 3300042597 | Unclassified | 1298 |
| 221 | Ga0123357_10269102 | 3300009784 | Bacteria | 1784 |
| 222 | Ga0123356_10010209 | 3300010049 | Bacteria | 9235 |
| 223 | Ga0123356_10038521 | 3300010049 | Bacteria | 4455 |
| 224 | Ga0123356_10056388 | 3300010049 | Unclassified | 3660 |
| 225 | Ga0123353_10114963 | 3300010167 | Bacteria | 4331 |
| 226 | Ga0123353_10118887 | 3300010167 | Bacteria | 4250 |
| 227 | Ga0123353_10185845 | 3300010167 | Bacteria | 3286 |
| 228 | Ga0466705_307838 | 3300042612 | Bacteria | 1253 |
| 229 | Ga0466704_170173 | 3300042643 | Bacteria | 13167 |
| 230 | Ga0466727_106896 | 3300042655 | Bacteria | 1830 |
| 231 | Ga0466727_274230 | 3300042655 | Bacteria | 1263 |
| 232 | AustNasuHG_c1016659 | 3300000089 | Bacteria | 2453 |
| 233 | JGI24698J34947_10015518 | 3300002449 | Bacteria | 4145 |
| 234 | JGI24698J34947_10194531 | 3300002449 | Unclassified | 800 |
| 235 | JGI24695J34938_10008462 | 3300002450 | Bacteria | 5862 |
| 236 | JGI24695J34938_10026949 | 3300002450 | Bacteria | 2723 |
| 237 | JGI24695J34938_10028568 | 3300002450 | Bacteria | 2619 |
| 238 | JGI24702J35022_10272949 | 3300002462 | Bacteria | 990 |
| 239 | JGI24699J35502_11110539 | 3300002509 | Unclassified | 2679 |
| 240 | Ga0072941_1018691 | 3300005201 | Bacteria | 12553 |
| 241 | Ga0072941_1104095 | 3300005201 | Bacteria | 3277 |
| 242 | Ga0466712_020256 | 3300042614 | Bacteria | 5159 |
| 243 | Ga0466712_322936 | 3300042614 | Unclassified | 2093 |
| 244 | Ga0466715_200314 | 3300042616 | Bacteria | 25554 |
| 245 | Ga0466715_393347 | 3300042616 | Bacteria | 2975 |
| 246 | Ga0466718_020280 | 3300042617 | Bacteria | 12226 |
| 247 | Ga0466718_115046 | 3300042617 | Bacteria | 1784 |
| 248 | Ga0466718_130857 | 3300042617 | Bacteria | 1113 |
| 249 | Ga0466723_160914 | 3300042618 | Bacteria | 17663 |
| 250 | Ga0466726_152227 | 3300042619 | Bacteria | 2287 |
| 251 | Ga0466707_213907 | 3300042601 | Bacteria | 1986 |
| 252 | Ga0466707_214002 | 3300042601 | Bacteria | 3613 |
| 253 | Ga0466716_012262 | 3300042605 | Bacteria | 1023 |
| 254 | Ga0466719_483406 | 3300042606 | Bacteria | 1271 |
| 255 | Ga0466722_063539 | 3300042609 | Bacteria | 6218 |
| 256 | Ga0466698_267719 | 3300042610 | Bacteria | 5636 |
| 257 | Ga0466698_364068 | 3300042610 | Bacteria | 1942 |
| 258 | Ga0264413_104132 | 3300024493 | Bacteria | 25431 |
| 259 | Ga0264413_110949 | 3300024493 | Unclassified | 3699 |
| 260 | Ga0456237_0003956 | 3300041968 | Unclassified | 2386 |
| 261 | Ga0456237_0004123 | 3300041968 | Bacteria | 2340 |
| 262 | Ga0466690_115132 | 3300042590 | Bacteria | 1893 |
| 263 | Ga0466690_156342 | 3300042590 | Bacteria | 1861 |
| 264 | Ga0466692_074349 | 3300042591 | Bacteria | 33582 |
| 265 | Ga0466692_138655 | 3300042591 | Bacteria | 4559 |
| 266 | Ga0466691_068524 | 3300042593 | Bacteria | 17914 |
| 267 | Ga0466691_169371 | 3300042593 | Bacteria | 6330 |
| 268 | Ga0466694_023621 | 3300042594 | Bacteria | 46663 |
| 269 | Ga0466694_122819 | 3300042594 | Bacteria | 3532 |
| 270 | Ga0466694_257622 | 3300042594 | Bacteria | 2880 |
| 271 | Ga0466696_008480 | 3300042596 | Bacteria | 1930 |
| 272 | Ga0123357_10050873 | 3300009784 | Bacteria | 5605 |
| 273 | Ga0123356_10006664 | 3300010049 | Bacteria | 11640 |
| 274 | Ga0123356_10418011 | 3300010049 | Bacteria | 1482 |
| 275 | Ga0123354_10252293 | 3300010882 | Bacteria | 1784 |
| 276 | Ga0466705_060678 | 3300042612 | Bacteria | 1851 |
| 277 | Ga0466705_218092 | 3300042612 | Bacteria | 4406 |
| 278 | Ga0466729_312061 | 3300042621 | Bacteria | 1181 |
| 279 | Ga0466702_165727 | 3300042635 | Bacteria | 1191 |
| 280 | Ga0466704_312857 | 3300042643 | Bacteria | 1750 |
| 281 | Ga0466709_375013 | 3300042648 | Bacteria | 13655 |
| 282 | AustNasuHG_c1057653 | 3300000089 | Bacteria | 773 |
| 283 | JGI24698J34947_10006021 | 3300002449 | Bacteria | 6659 |
| 284 | JGI24698J34947_10012561 | 3300002449 | Bacteria | 4641 |
| 285 | JGI24698J34947_10040716 | 3300002449 | Bacteria | 2397 |
| 286 | JGI24695J34938_10000673 | 3300002450 | Bacteria | 32282 |
| 287 | JGI24695J34938_10000989 | 3300002450 | Bacteria | 25804 |
| 288 | JGI24695J34938_10012463 | 3300002450 | Bacteria | 4503 |
| 289 | JGI24695J34938_10030774 | 3300002450 | Unclassified | 2496 |
| 290 | Ga0072940_1030086 | 3300005200 | Bacteria | 1207 |
| 291 | Ga0466732_013058 | 3300042656 | Bacteria | 11491 |
| 292 | Ga0466733_070681 | 3300042659 | Bacteria | 1924 |
| 293 | Ga0466712_031220 | 3300042614 | Bacteria | 14010 |
| 294 | Ga0466711_086068 | 3300042615 | Bacteria | 9631 |
| 295 | Ga0466715_269202 | 3300042616 | Bacteria | 2034 |
| 296 | Ga0466715_427158 | 3300042616 | Bacteria | 13811 |
| 297 | Ga0466718_029484 | 3300042617 | Bacteria | 1135 |
| 298 | Ga0466718_044351 | 3300042617 | Unclassified | 7174 |
| 299 | Ga0466718_141564 | 3300042617 | Unclassified | 2653 |
| 300 | Ga0466726_092590 | 3300042619 | Bacteria | 2216 |
| 301 | Ga0466728_313103 | 3300042620 | Bacteria | 2192 |
| 302 | Ga0466707_385476 | 3300042601 | Bacteria | 2063 |
| 303 | Ga0466713_094815 | 3300042602 | Unclassified | 1616 |
| 304 | Ga0466720_005069 | 3300042607 | Bacteria | 9617 |
| 305 | Ga0466720_033381 | 3300042607 | Bacteria | 1453 |
| 306 | Ga0466720_034367 | 3300042607 | Bacteria | 5431 |
| 307 | Ga0466722_044237 | 3300042609 | Bacteria | 10604 |
| 308 | Ga0255786_1006615 | 3300022815 | Bacteria | 798 |
| 309 | Ga0264413_115035 | 3300024493 | Unclassified | 3002 |
| 310 | Ga0264413_157626 | 3300024493 | Unclassified | 2161 |
| 311 | Ga0415639_008152 | 3300038395 | Bacteria | 7978 |
| 312 | Ga0466692_075074 | 3300042591 | Bacteria | 15170 |
| 313 | Ga0466694_137635 | 3300042594 | Bacteria | 6257 |
| 314 | Ga0466699_098650 | 3300042597 | Bacteria | 4959 |
| 315 | Ga0466699_155435 | 3300042597 | Bacteria | 2216 |
| 316 | Ga0466699_387861 | 3300042597 | Unclassified | 1873 |
| 317 | Ga0123353_10178921 | 3300010167 | Bacteria | 3360 |
| 318 | Ga0123353_10248661 | 3300010167 | Bacteria | 2756 |
| 319 | Ga0123353_10613913 | 3300010167 | Bacteria | 1550 |
| 320 | Ga0123353_10862328 | 3300010167 | Bacteria | 1239 |
| 321 | Ga0466705_076299 | 3300042612 | Bacteria | 2465 |
| 322 | Ga0466727_316049 | 3300042655 | Bacteria | 1831 |
| 323 | AustNasuHG_c1005355 | 3300000089 | Bacteria | 4584 |
| 324 | AustNasuHG_c1036180 | 3300000089 | Bacteria | 1286 |
| 325 | JGI24698J34947_10000430 | 3300002449 | Bacteria | 19280 |
| 326 | JGI24698J34947_10099146 | 3300002449 | Bacteria | 1315 |
| 327 | JGI24695J34938_10008691 | 3300002450 | Bacteria | 5768 |
| 328 | JGI24702J35022_10047188 | 3300002462 | Bacteria | 2293 |
| 329 | Ga0074263_109577 | 3300005485 | Bacteria | 3009 |
| 330 | Ga0466732_167957 | 3300042656 | Bacteria | 4469 |
| 331 | Ga0466712_047830 | 3300042614 | Bacteria | 3038 |
| 332 | Ga0466712_067542 | 3300042614 | Bacteria | 3101 |
| 333 | Ga0466712_103721 | 3300042614 | Bacteria | 4046 |
| 334 | Ga0466712_253757 | 3300042614 | Bacteria | 7970 |
| 335 | Ga0466711_047179 | 3300042615 | Bacteria | 21134 |
| 336 | Ga0466718_073358 | 3300042617 | Bacteria | 27999 |
| 337 | Ga0466718_083549 | 3300042617 | Unclassified | 1266 |
| 338 | Ga0466728_396871 | 3300042620 | Bacteria | 2165 |
| 339 | Ga0466729_155009 | 3300042621 | Bacteria | 1509 |
| 340 | Ga0466706_155025 | 3300042599 | Bacteria | 1181 |
| 341 | Ga0466700_226586 | 3300042600 | Bacteria | 1927 |
| 342 | Ga0466707_167682 | 3300042601 | Bacteria | 13743 |
| 343 | Ga0466714_022494 | 3300042603 | Bacteria | 1842 |
| 344 | Ga0466720_114444 | 3300042607 | Bacteria | 17733 |
| 345 | Ga0466720_133327 | 3300042607 | Bacteria | 41983 |
| 346 | Ga0466721_122613 | 3300042608 | Bacteria | 1319 |
| 347 | Ga0466722_026082 | 3300042609 | Bacteria | 16948 |
| 348 | Ga0466722_216539 | 3300042609 | Bacteria | 2310 |
| 349 | Ga0415639_077578 | 3300038395 | Bacteria | 2133 |
| 350 | Ga0466692_167727 | 3300042591 | Bacteria | 5007 |
| 351 | Ga0466695_021411 | 3300042595 | Bacteria | 9397 |
| 352 | Ga0466699_306737 | 3300042597 | Unclassified | 2982 |
| 353 | Ga0123356_10000116 | 3300010049 | Bacteria | 86622 |
| 354 | Ga0123356_10067043 | 3300010049 | Bacteria | 3361 |
| 355 | Ga0123356_10163009 | 3300010049 | Bacteria | 2230 |
| 356 | Ga0123356_11106002 | 3300010049 | Bacteria | 961 |
| 357 | Ga0466705_064763 | 3300042612 | Bacteria | 3532 |
| 358 | Ga0466702_168242 | 3300042635 | Bacteria | 1405 |
| 359 | Ga0466702_269034 | 3300042635 | Bacteria | 1840 |
| 360 | Ga0466704_161082 | 3300042643 | Unclassified | 4069 |
| 361 | Ga0466704_554892 | 3300042643 | Bacteria | 39000 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF05191 | GO:0004017 | adenylate kinase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.