Protein Family IF06339
Metagenome
Isolate
254
Members
100
Samples
214
Scaffolds
227.26
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_122952|Ga0466716_122952_3039_3773
- Length
- 244 aa
- Sequence
- MMRIDILSVLPEMMEGMLNCSIVKRAQDKGLVEVHLHNLRDYAANRWRRVDDAPFGGEAGMVIRIEPVDRALTALTSRRDYEDIIYTSPDGELFTQSMANRFSARGGNLIILCGHYKGIDHRIREHLITREISIGDYVLTGGEIPAAVITDAIVRLLPGAIGDEQSALTDSFQDGLLAPPVYTRPAEYRGWQVPEVLLSGHDRLIADWRLQQAQDRTASLRPSLVTLEDQSKREGKEAGRGRER
Sample Types
Isolate
15.8%
Metagenome
84.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.5%
Blattidae
23.5%
Unclassified
15.3%
Kalotermitidae
14.3%
Rhinotermitidae
4.1%
Termopsidae
4.1%
Drosophilidae
3.1%
Passalidae
3.1%
Tenebrionidae
2.0%
Apidae
1.0%
Formicidae
1.0%
Hodotermitidae
1.0%
Elmidae
1.0%
Hydrophilidae
1.0%
Taxonomy
Archaea
0
Bacteria
245
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 2 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 6 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 15 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 16 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 17 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 18 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 19 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 20 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 21 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 22 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 27 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 28 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 29 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 30 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 31 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 38 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 45 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 46 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 47 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 48 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 49 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 50 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 51 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 52 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 53 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 54 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 55 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 56 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 57 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 58 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 59 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 60 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 61 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 62 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 63 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 64 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 65 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 66 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 67 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 68 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 69 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 70 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 71 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 72 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 73 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 74 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 75 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 76 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 77 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 78 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 79 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 80 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 81 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 82 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 83 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 84 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 85 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 86 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 87 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 88 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 89 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 90 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 91 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 92 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 93 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 94 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 95 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 96 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 97 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 98 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 99 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 100 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_274903 | 3300042611 | Unclassified | 1214 |
| 2 | Ga0466705_011920 | 3300042612 | Bacteria | 8370 |
| 3 | Ga0466690_365628 | 3300042590 | Bacteria | 1381 |
| 4 | Ga0466696_255699 | 3300042596 | Bacteria | 21807 |
| 5 | Ga0466696_351655 | 3300042596 | Bacteria | 8580 |
| 6 | Ga0123356_10108132 | 3300010049 | Bacteria | 2681 |
| 7 | Ga0123356_10241818 | 3300010049 | Bacteria | 1877 |
| 8 | Ga0123353_10159076 | 3300010167 | Bacteria | 3598 |
| 9 | 2227644620 | 2225789004 | Bacteria | 2038 |
| 10 | JGI24702J35022_10000738 | 3300002462 | Bacteria | 20126 |
| 11 | JGI24702J35022_10001594 | 3300002462 | Bacteria | 14035 |
| 12 | JGI24702J35022_10095532 | 3300002462 | Bacteria | 1622 |
| 13 | JGI24705J35276_12223767 | 3300002504 | Bacteria | 2542 |
| 14 | Ga0104048_1169381 | 3300007143 | Bacteria | 2134 |
| 15 | Ga0466729_213959 | 3300042621 | Bacteria | 1700 |
| 16 | Ga0466727_311396 | 3300042655 | Bacteria | 1618 |
| 17 | Ga0466713_047868 | 3300042602 | Bacteria | 11022 |
| 18 | Ga0466716_255735 | 3300042605 | Bacteria | 2432 |
| 19 | Ga0466719_057413 | 3300042606 | Bacteria | 8151 |
| 20 | Ga0466722_063576 | 3300042609 | Bacteria | 7897 |
| 21 | Ga0466705_404415 | 3300042612 | Bacteria | 1021 |
| 22 | Ga0466726_359988 | 3300042619 | Unclassified | 7193 |
| 23 | Ga0466733_078629 | 3300042659 | Bacteria | 1953 |
| 24 | Ga0466733_124547 | 3300042659 | Bacteria | 1090 |
| 25 | Ga0456237_0000029 | 3300041968 | Bacteria | 21795 |
| 26 | Ga0466692_130683 | 3300042591 | Bacteria | 5264 |
| 27 | Ga0466691_023858 | 3300042593 | Bacteria | 13253 |
| 28 | Ga0466696_482834 | 3300042596 | Unclassified | 1216 |
| 29 | Ga0123356_10001831 | 3300010049 | Bacteria | 23078 |
| 30 | JGI24696J40584_12950976 | 3300002834 | Bacteria | 2198 |
| 31 | Ga0068302_10232190 | 3300005071 | Bacteria | 3218 |
| 32 | Ga0068305_10007699 | 3300005083 | Bacteria | 25243 |
| 33 | Ga0068305_10326020 | 3300005083 | Bacteria | 2304 |
| 34 | Ga0466734_039250 | 3300042623 | Bacteria | 1103 |
| 35 | Ga0466735_154748 | 3300042624 | Bacteria | 5446 |
| 36 | Ga0466703_062203 | 3300042636 | Bacteria | 10855 |
| 37 | Ga0466703_093482 | 3300042636 | Bacteria | 4623 |
| 38 | Ga0466703_241884 | 3300042636 | Bacteria | 19749 |
| 39 | Ga0466704_042272 | 3300042643 | Bacteria | 2540 |
| 40 | Ga0466704_049238 | 3300042643 | Bacteria | 1515 |
| 41 | Ga0466725_014447 | 3300042654 | Bacteria | 14898 |
| 42 | Ga0466725_026939 | 3300042654 | Bacteria | 2021 |
| 43 | Ga0466727_048312 | 3300042655 | Bacteria | 12310 |
| 44 | Ga0466727_307869 | 3300042655 | Bacteria | 1537 |
| 45 | Ga0466727_313003 | 3300042655 | Bacteria | 12461 |
| 46 | Ga0466706_016796 | 3300042599 | Bacteria | 2566 |
| 47 | Ga0466707_227296 | 3300042601 | Bacteria | 2151 |
| 48 | Ga0466707_276776 | 3300042601 | Bacteria | 4889 |
| 49 | Ga0466707_321147 | 3300042601 | Bacteria | 2180 |
| 50 | Ga0466707_323400 | 3300042601 | Bacteria | 1518 |
| 51 | Ga0466713_035445 | 3300042602 | Bacteria | 2707 |
| 52 | Ga0466713_154339 | 3300042602 | Bacteria | 3330 |
| 53 | Ga0466714_042919 | 3300042603 | Bacteria | 42705 |
| 54 | Ga0466716_122952 | 3300042605 | Bacteria | 4747 |
| 55 | Ga0466719_035644 | 3300042606 | Unclassified | 3207 |
| 56 | Ga0466722_042812 | 3300042609 | Bacteria | 110303 |
| 57 | Ga0466715_013014 | 3300042616 | Bacteria | 13560 |
| 58 | Ga0466715_067721 | 3300042616 | Bacteria | 3327 |
| 59 | Ga0466715_373317 | 3300042616 | Bacteria | 12645 |
| 60 | Ga0466715_502162 | 3300042616 | Bacteria | 1215 |
| 61 | Ga0466697_253712 | 3300042611 | Bacteria | 1881 |
| 62 | Ga0466697_257599 | 3300042611 | Bacteria | 1094 |
| 63 | Ga0466690_338681 | 3300042590 | Bacteria | 7292 |
| 64 | Ga0466692_140391 | 3300042591 | Bacteria | 136970 |
| 65 | Ga0466691_179997 | 3300042593 | Bacteria | 5918 |
| 66 | Ga0466701_012784 | 3300042598 | Bacteria | 94328 |
| 67 | Ga0123357_10018176 | 3300009784 | Bacteria | 9338 |
| 68 | 2227546855 | 2225789004 | Bacteria | 15206 |
| 69 | IMNBL1DRAFT_c0001047 | 3300000062 | Bacteria | 21395 |
| 70 | Ga0068305_10089976 | 3300005083 | Bacteria | 2152 |
| 71 | Ga0466729_229889 | 3300042621 | Bacteria | 2106 |
| 72 | Ga0466735_005463 | 3300042624 | Bacteria | 11774 |
| 73 | Ga0466704_126477 | 3300042643 | Bacteria | 9636 |
| 74 | Ga0466704_132880 | 3300042643 | Bacteria | 2410 |
| 75 | Ga0466704_411203 | 3300042643 | Bacteria | 4821 |
| 76 | Ga0466727_006923 | 3300042655 | Bacteria | 17119 |
| 77 | Ga0466727_340493 | 3300042655 | Bacteria | 2140 |
| 78 | Ga0466713_110836 | 3300042602 | Bacteria | 1763 |
| 79 | Ga0466711_142575 | 3300042615 | Bacteria | 12661 |
| 80 | Ga0466729_190196 | 3300042621 | Bacteria | 9799 |
| 81 | Ga0466705_376125 | 3300042612 | Bacteria | 32089 |
| 82 | Ga0466733_049100 | 3300042659 | Bacteria | 86078 |
| 83 | Ga0466656_113263 | 3300042550 | Bacteria | 33316 |
| 84 | Ga0466694_167455 | 3300042594 | Unclassified | 2616 |
| 85 | Ga0466694_373321 | 3300042594 | Bacteria | 4333 |
| 86 | Ga0466695_192825 | 3300042595 | Bacteria | 1036 |
| 87 | Ga0123356_10135700 | 3300010049 | Bacteria | 2418 |
| 88 | IMNBL1DRAFT_c0016113 | 3300000062 | Unclassified | 3213 |
| 89 | Ga0072940_1565932 | 3300005200 | Bacteria | 867 |
| 90 | Ga0104043_1010863 | 3300007058 | Bacteria | 2033 |
| 91 | Ga0104045_1082603 | 3300007085 | Bacteria | 1045 |
| 92 | Ga0466735_150295 | 3300042624 | Bacteria | 5337 |
| 93 | Ga0466730_003007 | 3300042625 | Bacteria | 2738 |
| 94 | Ga0466703_001188 | 3300042636 | Bacteria | 16315 |
| 95 | Ga0466725_400462 | 3300042654 | Bacteria | 1903 |
| 96 | Ga0466701_041320 | 3300042598 | Bacteria | 38924 |
| 97 | Ga0466713_094496 | 3300042602 | Bacteria | 333875 |
| 98 | Ga0466713_141379 | 3300042602 | Bacteria | 226907 |
| 99 | Ga0466714_149715 | 3300042603 | Bacteria | 4365 |
| 100 | Ga0466719_134154 | 3300042606 | Bacteria | 3330 |
| 101 | Ga0466719_209480 | 3300042606 | Bacteria | 12446 |
| 102 | Ga0466697_025100 | 3300042611 | Bacteria | 2890 |
| 103 | Ga0466710_162759 | 3300042613 | Bacteria | 7608 |
| 104 | Ga0466711_095888 | 3300042615 | Bacteria | 1211 |
| 105 | Ga0466711_307741 | 3300042615 | Bacteria | 3130 |
| 106 | Ga0466715_015717 | 3300042616 | Bacteria | 3274 |
| 107 | Ga0466728_406855 | 3300042620 | Bacteria | 92553 |
| 108 | Ga0466729_046641 | 3300042621 | Bacteria | 1076 |
| 109 | Ga0466705_064830 | 3300042612 | Bacteria | 19081 |
| 110 | Ga0466690_067242 | 3300042590 | Bacteria | 11901 |
| 111 | Ga0466699_348272 | 3300042597 | Bacteria | 1185 |
| 112 | Ga0123353_10001135 | 3300010167 | Bacteria | 32414 |
| 113 | Ga0123353_10148079 | 3300010167 | Unclassified | 3752 |
| 114 | 2227041499 | 2225789003 | Bacteria | 4163 |
| 115 | IMNBL1DRAFT_c0001100 | 3300000062 | Bacteria | 20718 |
| 116 | JGI24705J35276_12216306 | 3300002504 | Bacteria | 2041 |
| 117 | Ga0068302_10207671 | 3300005071 | Unclassified | 1282 |
| 118 | Ga0103267_1000248 | 3300007190 | Bacteria | 38664 |
| 119 | Ga0466704_140840 | 3300042643 | Bacteria | 9972 |
| 120 | Ga0466704_161699 | 3300042643 | Bacteria | 4901 |
| 121 | Ga0466704_435030 | 3300042643 | Bacteria | 2175 |
| 122 | Ga0466719_336149 | 3300042606 | Bacteria | 10022 |
| 123 | Ga0466722_207089 | 3300042609 | Bacteria | 6629 |
| 124 | Ga0466698_264138 | 3300042610 | Bacteria | 1359 |
| 125 | Ga0466711_296625 | 3300042615 | Bacteria | 5718 |
| 126 | Ga0466715_118872 | 3300042616 | Bacteria | 2042 |
| 127 | Ga0466715_504085 | 3300042616 | Bacteria | 1806 |
| 128 | Ga0466723_200153 | 3300042618 | Bacteria | 4962 |
| 129 | Ga0466705_040378 | 3300042612 | Bacteria | 10928 |
| 130 | Ga0265387_1004180 | 3300024582 | Bacteria | 1974 |
| 131 | Ga0466692_131830 | 3300042591 | Bacteria | 1298 |
| 132 | Ga0466693_270649 | 3300042592 | Bacteria | 4575 |
| 133 | Ga0466696_403598 | 3300042596 | Bacteria | 1751 |
| 134 | Ga0466701_007547 | 3300042598 | Bacteria | 1191 |
| 135 | Ga0123356_10103164 | 3300010049 | Bacteria | 2739 |
| 136 | Ga0123353_10011706 | 3300010167 | Bacteria | 12382 |
| 137 | 2227444705 | 2225789004 | Bacteria | 5459 |
| 138 | JGI24702J35022_10006416 | 3300002462 | Bacteria | 6801 |
| 139 | Ga0068302_10241537 | 3300005071 | Unclassified | 2604 |
| 140 | Ga0466731_261419 | 3300042622 | Bacteria | 2017 |
| 141 | Ga0466735_079526 | 3300042624 | Bacteria | 2797 |
| 142 | Ga0466735_227342 | 3300042624 | Bacteria | 16781 |
| 143 | Ga0466709_404564 | 3300042648 | Bacteria | 2556 |
| 144 | Ga0466727_049611 | 3300042655 | Bacteria | 6229 |
| 145 | Ga0466701_017057 | 3300042598 | Bacteria | 176601 |
| 146 | Ga0466707_010835 | 3300042601 | Bacteria | 2186 |
| 147 | Ga0466713_052081 | 3300042602 | Bacteria | 20806 |
| 148 | Ga0466713_077466 | 3300042602 | Bacteria | 18852 |
| 149 | Ga0466713_140868 | 3300042602 | Bacteria | 5942 |
| 150 | Ga0466714_015825 | 3300042603 | Bacteria | 102725 |
| 151 | Ga0466714_051455 | 3300042603 | Bacteria | 64684 |
| 152 | Ga0466716_341024 | 3300042605 | Bacteria | 15317 |
| 153 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 154 | Ga0466698_232301 | 3300042610 | Bacteria | 2650 |
| 155 | Ga0466710_011861 | 3300042613 | Bacteria | 2383 |
| 156 | Ga0466710_356096 | 3300042613 | Bacteria | 1584 |
| 157 | Ga0466711_144994 | 3300042615 | Bacteria | 8495 |
| 158 | Ga0466715_305053 | 3300042616 | Bacteria | 7166 |
| 159 | Ga0466723_319357 | 3300042618 | Bacteria | 15607 |
| 160 | Ga0466728_306930 | 3300042620 | Bacteria | 116996 |
| 161 | Ga0466697_197195 | 3300042611 | Bacteria | 3018 |
| 162 | Ga0466705_107346 | 3300042612 | Bacteria | 4851 |
| 163 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 164 | Ga0466690_015292 | 3300042590 | Bacteria | 19217 |
| 165 | Ga0466691_193720 | 3300042593 | Bacteria | 4186 |
| 166 | Ga0466696_007412 | 3300042596 | Bacteria | 1059 |
| 167 | JGI24702J35022_10007937 | 3300002462 | Bacteria | 6043 |
| 168 | Ga0068305_10099242 | 3300005083 | Bacteria | 9745 |
| 169 | Ga0123357_10002650 | 3300009784 | Bacteria | 20127 |
| 170 | Ga0466735_036493 | 3300042624 | Bacteria | 3784 |
| 171 | Ga0466735_200765 | 3300042624 | Bacteria | 3953 |
| 172 | Ga0466735_215120 | 3300042624 | Bacteria | 1083 |
| 173 | Ga0466703_076456 | 3300042636 | Bacteria | 9965 |
| 174 | Ga0466703_319363 | 3300042636 | Bacteria | 11975 |
| 175 | Ga0466704_076869 | 3300042643 | Bacteria | 1919 |
| 176 | Ga0466704_519961 | 3300042643 | Bacteria | 10306 |
| 177 | Ga0466709_178365 | 3300042648 | Bacteria | 5439 |
| 178 | Ga0466709_343223 | 3300042648 | Bacteria | 7256 |
| 179 | Ga0466708_091158 | 3300042652 | Bacteria | 15984 |
| 180 | Ga0466708_429470 | 3300042652 | Bacteria | 14783 |
| 181 | Ga0466700_362188 | 3300042600 | Bacteria | 1218 |
| 182 | Ga0466713_067919 | 3300042602 | Bacteria | 1453 |
| 183 | Ga0466714_094362 | 3300042603 | Bacteria | 1505 |
| 184 | Ga0466716_130337 | 3300042605 | Bacteria | 20942 |
| 185 | Ga0466722_145537 | 3300042609 | Bacteria | 1576 |
| 186 | Ga0466710_227153 | 3300042613 | Bacteria | 4966 |
| 187 | Ga0466715_057287 | 3300042616 | Bacteria | 64422 |
| 188 | Ga0466715_096303 | 3300042616 | Bacteria | 18483 |
| 189 | Ga0466733_066581 | 3300042659 | Bacteria | 19447 |
| 190 | Ga0466690_267682 | 3300042590 | Bacteria | 2841 |
| 191 | Ga0466694_031050 | 3300042594 | Bacteria | 4558 |
| 192 | Ga0466695_321732 | 3300042595 | Bacteria | 2501 |
| 193 | Ga0466696_463691 | 3300042596 | Bacteria | 1338 |
| 194 | Ga0466699_437321 | 3300042597 | Bacteria | 2273 |
| 195 | Ga0123353_10030362 | 3300010167 | Bacteria | 8351 |
| 196 | Ga0123353_10132619 | 3300010167 | Bacteria | 3997 |
| 197 | Ga0123354_10013074 | 3300010882 | Bacteria | 12863 |
| 198 | JGI24702J35022_10004041 | 3300002462 | Bacteria | 8780 |
| 199 | JGI24702J35022_10185263 | 3300002462 | Bacteria | 1185 |
| 200 | JGI24699J35502_11133379 | 3300002509 | Bacteria | 10198 |
| 201 | Ga0466735_114041 | 3300042624 | Bacteria | 10723 |
| 202 | Ga0466703_052112 | 3300042636 | Bacteria | 6467 |
| 203 | Ga0466704_183476 | 3300042643 | Bacteria | 13925 |
| 204 | Ga0466706_092879 | 3300042599 | Bacteria | 2031 |
| 205 | Ga0466700_096040 | 3300042600 | Bacteria | 23234 |
| 206 | Ga0466707_262205 | 3300042601 | Bacteria | 6853 |
| 207 | Ga0466707_346613 | 3300042601 | Bacteria | 17564 |
| 208 | Ga0466713_049042 | 3300042602 | Bacteria | 18614 |
| 209 | Ga0466713_062777 | 3300042602 | Bacteria | 57659 |
| 210 | Ga0466722_032792 | 3300042609 | Bacteria | 5748 |
| 211 | Ga0466715_046669 | 3300042616 | Bacteria | 6502 |
| 212 | Ga0466715_409757 | 3300042616 | Bacteria | 45403 |
| 213 | Ga0466726_373213 | 3300042619 | Bacteria | 4716 |
| 214 | Ga0466728_393954 | 3300042620 | Bacteria | 12402 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01746 | tRNA_m1G_MT | tRNA (Guanine-1)-methyltransferase | 24 | 222 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.