Protein Family IF06289

Metagenome Isolate
168 Members
110 Samples
124 Scaffolds
210.62 Avg Length

🧬 Representative Sequence

ID
3300042604|Ga0466717_296892|Ga0466717_296892_4310_4981
Length
223 aa
Sequence
LNDASEIFVKETTMKLWSNSFTNLNLIPGEYAFCVIDATHHVALSGNRNPHLAWSEAPPNTQSFVLICYDKDVPSRGDDVNKEDREVPASLPRVDFFHWVLIDIPAAQREIEAGSYSHGVTARGKPEVLPALGNMRHGINDYTSWFAGDAEMRGDYYGYDGPCPPWNDSIVHQYIFTLYALDVPRLRVDGQLSGQAVRLAMQKYILAQASLMGLYTLNPRLAK

📊 Sample Types

Isolate 26.2%
Metagenome 73.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 16.4%
Unclassified 13.6%
Formicidae 11.8%
Anthocoridae 11.8%
Kalotermitidae 10.0%
Culicidae 8.2%
Curculionidae 6.4%
Elmidae 6.4%
Drosophilidae 5.5%
Rhinotermitidae 1.8%
Apidae 1.8%
Armadillidiidae 1.8%
Termopsidae 1.8%
Passalidae 0.9%
Crambidae 0.9%
Alydidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 151
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
4 8100455565 Delftia sp. S67 Isolate Curculionidae
5 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
6 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
11 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
12 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
13 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
14 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
15 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
16 3300007088 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut Metagenome Drosophilidae
17 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
18 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
19 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
20 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
21 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
22 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
23 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
26 2978161719 Serratia marcescens KZ2 Isolate Apidae
27 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
28 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
29 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
30 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
34 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
35 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
36 2820951912 Unclassified Acidobacteria Emb289P4bin26 Isolate Unclassified
37 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
38 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
39 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
40 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
41 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
42 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
43 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
44 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
45 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
46 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
47 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
48 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
49 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
50 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
51 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
52 2864937364 Acidovorax soli S00198 Isolate Elmidae
53 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
54 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
55 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
56 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
57 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
58 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
59 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
60 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
61 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
62 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
63 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
64 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
65 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
66 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
67 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
68 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
69 2937735258 Serratia marcescens KZ11 Isolate Apidae
70 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
71 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
72 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
73 8100461708 Delftia sp. S65 Isolate Curculionidae
74 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
75 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
76 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
77 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
78 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
79 2603880165 Burkholderiales A1 Isolate Unclassified
80 2603880170 Burkholderiales A2 Isolate Unclassified
81 2603880172 Burkholderiales C Isolate Unclassified
82 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
83 8103002986 Erwinia sp. S38 Isolate Curculionidae
84 8103008710 Erwinia sp. S43 Isolate Curculionidae
85 3300005306 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 1 gut Metagenome Drosophilidae
86 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
87 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
88 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
89 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
90 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
91 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
92 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
93 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
94 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
95 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
96 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
97 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
98 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
99 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
100 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
101 8100449422 Delftia sp. S66 Isolate Curculionidae
102 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
103 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
104 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
105 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
106 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
107 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
108 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
109 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
110 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_212227 3300042611 Bacteria 1388
2 IMNBL1DRAFT_c0001579 3300000062 Bacteria 16943
3 CVPL010W_10015599 3300002931 Bacteria 7718
4 CVPL005L_10001011 3300002938 Bacteria 31524
5 Ga0102734_1002219 3300007129 Bacteria 4617
6 Ga0102738_1002141 3300007141 Bacteria 2971
7 Ga0103264_1000006 3300007188 Bacteria 148290
8 Ga0105005_1136525 3300007505 Unclassified 6198
9 Ga0466725_294995 3300042654 Bacteria 11384
10 Ga0123355_10056606 3300009826 Bacteria 6344
11 Ga0123356_10432232 3300010049 Bacteria 1461
12 Ga0160458_101957 3300012832 Bacteria 3057
13 Ga0160460_105194 3300012845 Unclassified 1894
14 Ga0160448_100185 3300012854 Bacteria 26347
15 Ga0160436_1002808 3300012861 Unclassified 4343
16 Ga0466657_225958 3300042582 Bacteria 10813
17 Ga0466657_269970 3300042582 Bacteria 5068
18 Ga0466701_097340 3300042598 Bacteria 56688
19 Ga0466716_086703 3300042605 Bacteria 9202
20 Ga0466719_066365 3300042606 Bacteria 15323
21 JGI24696J40584_12854254 3300002834 Bacteria 991
22 Ga0104049_1000283 3300007103 Bacteria 2790
23 Ga0102740_1015366 3300007140 Bacteria 1177
24 Ga0103264_1000386 3300007188 Bacteria 23118
25 Ga0466704_520082 3300042643 Bacteria 4944
26 Ga0123355_10184914 3300009826 Bacteria 3084
27 Ga0123354_10000255 3300010882 Bacteria 47810
28 Ga0160436_1002908 3300012861 Unclassified 4271
29 Ga0466693_427178 3300042592 Unclassified 1092
30 Ga0466691_170386 3300042593 Bacteria 1399
31 Ga0466701_101121 3300042598 Bacteria 13584
32 Ga0074188_1155962 3300005318 Unclassified 1875
33 Ga0104041_1003207 3300007106 Bacteria 10957
34 Ga0466715_421122 3300042616 Bacteria 1380
35 Ga0466728_108546 3300042620 Bacteria 4247
36 Ga0466724_35850 3300042649 Bacteria 120573
37 Ga0160458_100011 3300012832 Bacteria 403207
38 Ga0466690_129001 3300042590 Bacteria 52374
39 Ga0466701_025399 3300042598 Unclassified 1117
40 Ga0466722_076110 3300042609 Bacteria 2178
41 Ga0466697_025338 3300042611 Bacteria 3518
42 Ga0466705_318380 3300042612 Bacteria 2441
43 SPBB_contig01483 2044078006 Bacteria 166304
44 CVPL005L_10002651 3300002938 Bacteria 20331
45 Ga0074303_1075276 3300005306 Unclassified 1505
46 Ga0103263_103186 3300007042 Unclassified 1973
47 Ga0104047_1121911 3300007088 Unclassified 1128
48 Ga0102734_1008391 3300007129 Bacteria 5380
49 Ga0466710_088921 3300042613 Bacteria 9562
50 Ga0466710_210705 3300042613 Bacteria 3391
51 Ga0466710_416659 3300042613 Bacteria 3955
52 Ga0466715_208315 3300042616 Bacteria 5634
53 Ga0466730_013812 3300042625 Bacteria 185537
54 Ga0466724_63133 3300042649 Bacteria 2810
55 Ga0123357_10076357 3300009784 Unclassified 4424
56 Ga0160468_100063 3300012819 Bacteria 148097
57 Ga0160446_101939 3300012835 Bacteria 3902
58 Ga0160434_100032 3300012850 Bacteria 120271
59 Ga0466696_022758 3300042596 Bacteria 3324
60 Ga0466733_055935 3300042659 Bacteria 2040
61 CVPL005W_1000027 3300002934 Bacteria 52318
62 Ga0103261_1000985 3300007083 Bacteria 4449
63 Ga0103264_1025441 3300007188 Bacteria 2807
64 Ga0103264_1040311 3300007188 Bacteria 1996
65 Ga0466710_039713 3300042613 Bacteria 2625
66 Ga0466726_021117 3300042619 Bacteria 4960
67 Ga0466724_37273 3300042649 Bacteria 1340
68 Ga0123354_10000024 3300010882 Bacteria 118691
69 Ga0123354_10099949 3300010882 Bacteria 3931
70 Ga0466690_121661 3300042590 Bacteria 3056
71 Ga0466692_101940 3300042591 Bacteria 50488
72 Ga0466696_036930 3300042596 Bacteria 6923
73 Ga0466696_134534 3300042596 Bacteria 3065
74 Ga0466701_005129 3300042598 Bacteria 3392
75 Ga0466701_025431 3300042598 Unclassified 1549
76 Ga0466697_031615 3300042611 Bacteria 2544
77 Ga0466705_350039 3300042612 Bacteria 3378
78 DPO_contig00424 2032320009 Bacteria 23497
79 Ga0103261_1003499 3300007083 Bacteria 2430
80 Ga0103260_1000990 3300007139 Bacteria 5235
81 Ga0102740_1002268 3300007140 Unclassified 4476
82 Ga0102737_1002340 3300007142 Bacteria 4754
83 Ga0103264_1000510 3300007188 Bacteria 36323
84 Ga0466710_067864 3300042613 Bacteria 3864
85 Ga0466711_115466 3300042615 Bacteria 7970
86 Ga0466734_162035 3300042623 Bacteria 16770
87 Ga0466704_288860 3300042643 Bacteria 2212
88 Ga0466727_143538 3300042655 Bacteria 3953
89 Ga0160446_101748 3300012835 Bacteria 4280
90 Ga0160435_1000212 3300012857 Bacteria 28327
91 Ga0466694_377649 3300042594 Bacteria 9090
92 Ga0466717_296892 3300042604 Bacteria 6211
93 Ga0466697_232817 3300042611 Bacteria 1033
94 CVPL010W_10006354 3300002931 Bacteria 21839
95 CVPL005L_10007640 3300002938 Unclassified 10078
96 Ga0102736_1002504 3300007052 Bacteria 5399
97 Ga0103266_1000735 3300007067 Bacteria 6106
98 Ga0104041_1117390 3300007106 Bacteria 1202
99 Ga0102737_1000367 3300007142 Bacteria 15226
100 Ga0105005_1032231 3300007505 Unclassified 12226
101 Ga0466704_617252 3300042643 Bacteria 3961
102 Ga0160456_100132 3300012820 Bacteria 70951
103 Ga0160460_101552 3300012845 Bacteria 7305
104 Ga0415639_283762 3300038395 Bacteria 1545
105 Ga0466701_036096 3300042598 Bacteria 59976
106 Ga0466701_102522 3300042598 Bacteria 2295
107 Ga0466717_253861 3300042604 Bacteria 1365
108 Ga0466705_179154 3300042612 Bacteria 1025
109 Ga0104049_1025041 3300007103 Bacteria 3810
110 Ga0102737_1000651 3300007142 Bacteria 11073
111 Ga0103264_1000206 3300007188 Bacteria 33853
112 Ga0103264_1000240 3300007188 Bacteria 40495
113 Ga0103264_1000470 3300007188 Bacteria 20696
114 Ga0123357_10000234 3300009784 Bacteria 52576
115 Ga0466723_039361 3300042618 Unclassified 3808
116 Ga0466734_010742 3300042623 Bacteria 3748
117 Ga0466730_001347 3300042625 Unclassified 34704
118 Ga0466704_014985 3300042643 Bacteria 7420
119 Ga0466725_285254 3300042654 Bacteria 86814
120 Ga0160472_103698 3300012839 Bacteria 2927
121 Ga0160460_100364 3300012845 Bacteria 30732
122 Ga0160447_100740 3300012849 Bacteria 14113
123 Ga0466693_181172 3300042592 Bacteria 3255
124 Ga0466701_046632 3300042598 Bacteria 3708

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01161 PBP Phosphatidylethanolamine-binding protein 43 215 0.87

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.