Protein Family IF06132
Metagenome
Isolate
421
Members
152
Samples
348
Scaffolds
226.71
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_119093|Ga0466713_119093_27828_28625
- Length
- 265 aa
- Sequence
- MSHWQFSGLSDISIANVMLFFHKIPFGKLFDEIYFKYKNSIMYWILFIGIALMSWLVSANLKRKFANYSKIPVSNGMTGREIAEKMLHDNGIYDVQVISTPGSLTDHYNPANKTVNLSEGVYESNSIAAAAVAAHECGHAVQHAAAYAPLKMRSALVPVVSFSSNILSWVLLGGMLLLHVFPFLLLFGIILFALTTLFSFITLPVEINASRRAIAWLSNAGITDVRTHDKAVSALRSAAYTYVVAALGSLATLAYYIWIFMGRRN
Sample Types
Isolate
17.3%
Metagenome
82.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
19.1%
Termitidae
18.4%
Kalotermitidae
9.9%
Cryptocercidae
8.5%
Unclassified
6.4%
Culicidae
5.0%
Armadillidiidae
5.0%
Elmidae
4.3%
Apidae
3.5%
Rhinotermitidae
2.8%
Formicidae
2.8%
Drosophilidae
2.8%
Termopsidae
2.8%
Passalidae
1.4%
Blaberidae
1.4%
Tryonicidae
0.7%
Hodotermitidae
0.7%
Daphniidae
0.7%
Hydrophilidae
0.7%
Bombycidae
0.7%
Cambaridae
0.7%
Tenebrionidae
0.7%
Lamproblattidae
0.7%
Taxonomy
Archaea
0
Bacteria
405
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 2 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 3 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 4 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 5 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 6 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 7 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 8 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 9 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 10 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 11 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 12 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 13 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 14 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 15 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 16 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 17 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 18 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 24 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 25 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 26 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 27 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 28 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 29 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 30 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 31 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 32 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 33 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 34 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 37 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 38 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 39 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 40 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 41 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 42 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 43 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 44 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 45 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 46 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 47 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 48 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 49 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 50 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 51 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 52 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 53 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 54 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 55 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 56 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 57 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 58 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 59 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 60 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 61 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 62 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 63 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 64 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 65 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 66 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 67 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 68 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 69 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 70 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 71 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 72 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 73 | 3300005308 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 1 gut | Metagenome | Drosophilidae |
| 74 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 75 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 76 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 77 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 78 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 79 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 80 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 81 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 82 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 83 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 84 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 85 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 86 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 87 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 88 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 89 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 90 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 91 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 92 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 93 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 94 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 95 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 96 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 97 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 98 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 99 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 100 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 101 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 102 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 103 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 104 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 105 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 106 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 107 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 108 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 109 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 110 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 111 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 112 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 113 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 114 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 115 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 116 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 117 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 118 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 119 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 120 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 121 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 122 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 123 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 124 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 125 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 126 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 127 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 128 | 2820916033 | Unclassified Actinobacteria Emb289P3bin63 | Isolate | Unclassified |
| 129 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 130 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 131 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 132 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 133 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 134 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 135 | 8071415077 | Blattabacterium cuenoti MACROPArhi | Isolate | Blaberidae |
| 136 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 137 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 138 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 139 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 140 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 141 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 142 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 143 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 144 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 145 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 146 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 147 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 148 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 149 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 150 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 151 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 152 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_015446 | 3300042659 | Bacteria | 9914 |
| 2 | Ga0466733_221141 | 3300042659 | Bacteria | 323281 |
| 3 | Ga0160472_100074 | 3300012839 | Bacteria | 164726 |
| 4 | Ga0265387_1002529 | 3300024582 | Bacteria | 2570 |
| 5 | Ga0466656_218669 | 3300042550 | Bacteria | 33170 |
| 6 | Ga0466691_049625 | 3300042593 | Bacteria | 18024 |
| 7 | Ga0466691_074855 | 3300042593 | Unclassified | 2902 |
| 8 | Ga0466691_192727 | 3300042593 | Bacteria | 78524 |
| 9 | Ga0466735_027074 | 3300042624 | Bacteria | 5063 |
| 10 | Ga0466703_216431 | 3300042636 | Bacteria | 2144 |
| 11 | Ga0466703_230441 | 3300042636 | Bacteria | 6680 |
| 12 | Ga0466704_377132 | 3300042643 | Bacteria | 30337 |
| 13 | Ga0466709_208650 | 3300042648 | Bacteria | 37365 |
| 14 | Ga0466708_120549 | 3300042652 | Bacteria | 29332 |
| 15 | Ga0466725_297803 | 3300042654 | Bacteria | 25445 |
| 16 | Ga0466727_093411 | 3300042655 | Bacteria | 9772 |
| 17 | Ga0466706_083960 | 3300042599 | Bacteria | 1916 |
| 18 | Ga0466706_109799 | 3300042599 | Bacteria | 205088 |
| 19 | Ga0466714_026031 | 3300042603 | Bacteria | 36938 |
| 20 | Ga0466714_078840 | 3300042603 | Bacteria | 25683 |
| 21 | Ga0466714_101842 | 3300042603 | Bacteria | 80008 |
| 22 | Ga0466717_313590 | 3300042604 | Bacteria | 2162 |
| 23 | Ga0466716_102781 | 3300042605 | Bacteria | 4636 |
| 24 | Ga0466722_046312 | 3300042609 | Bacteria | 5245 |
| 25 | Ga0466722_088955 | 3300042609 | Bacteria | 6549 |
| 26 | Ga0466712_019583 | 3300042614 | Bacteria | 1911 |
| 27 | Ga0466711_071138 | 3300042615 | Bacteria | 11278 |
| 28 | Ga0466715_477561 | 3300042616 | Bacteria | 36126 |
| 29 | Ga0466728_238950 | 3300042620 | Bacteria | 8055 |
| 30 | Ga0466728_313523 | 3300042620 | Bacteria | 2093 |
| 31 | 2227646830 | 2225789004 | Bacteria | 43397 |
| 32 | IMNBL1DRAFT_c0029578 | 3300000062 | Bacteria | 2024 |
| 33 | IMNBL1DRAFT_c0052469 | 3300000062 | Bacteria | 1277 |
| 34 | JGI24702J35022_10026767 | 3300002462 | Bacteria | 3104 |
| 35 | Ga0068302_10018350 | 3300005071 | Bacteria | 4355 |
| 36 | Ga0068302_10160444 | 3300005071 | Bacteria | 2655 |
| 37 | Ga0068305_10131357 | 3300005083 | Bacteria | 9454 |
| 38 | Ga0104048_1002255 | 3300007143 | Bacteria | 3997 |
| 39 | Ga0466697_148746 | 3300042611 | Bacteria | 1231 |
| 40 | Ga0466705_372061 | 3300042612 | Bacteria | 3318 |
| 41 | Ga0466733_044778 | 3300042659 | Bacteria | 16733 |
| 42 | Ga0466733_055942 | 3300042659 | Bacteria | 81955 |
| 43 | Ga0466733_203604 | 3300042659 | Bacteria | 66833 |
| 44 | Ga0160443_100036 | 3300012848 | Bacteria | 326466 |
| 45 | Ga0466691_225066 | 3300042593 | Bacteria | 8223 |
| 46 | Ga0466696_175589 | 3300042596 | Bacteria | 53710 |
| 47 | Ga0466696_180567 | 3300042596 | Bacteria | 3924 |
| 48 | Ga0466735_074110 | 3300042624 | Bacteria | 2589 |
| 49 | Ga0466703_309294 | 3300042636 | Bacteria | 9872 |
| 50 | Ga0466704_120771 | 3300042643 | Bacteria | 5017 |
| 51 | Ga0466704_326711 | 3300042643 | Bacteria | 5464 |
| 52 | Ga0466709_214603 | 3300042648 | Bacteria | 12163 |
| 53 | Ga0466709_403245 | 3300042648 | Bacteria | 3082 |
| 54 | Ga0466724_65779 | 3300042649 | Unclassified | 1955 |
| 55 | Ga0466708_296615 | 3300042652 | Bacteria | 28218 |
| 56 | Ga0466727_344760 | 3300042655 | Bacteria | 6977 |
| 57 | Ga0466706_130683 | 3300042599 | Bacteria | 28902 |
| 58 | Ga0466707_030974 | 3300042601 | Bacteria | 21034 |
| 59 | Ga0466713_028910 | 3300042602 | Bacteria | 114900 |
| 60 | Ga0466713_038726 | 3300042602 | Unclassified | 10088 |
| 61 | Ga0466713_053051 | 3300042602 | Bacteria | 65032 |
| 62 | Ga0466713_082780 | 3300042602 | Bacteria | 4839 |
| 63 | Ga0466713_123723 | 3300042602 | Bacteria | 198668 |
| 64 | Ga0466714_074211 | 3300042603 | Bacteria | 1964 |
| 65 | Ga0466714_122843 | 3300042603 | Bacteria | 8576 |
| 66 | Ga0466714_131809 | 3300042603 | Bacteria | 3282 |
| 67 | Ga0466716_009949 | 3300042605 | Bacteria | 14338 |
| 68 | Ga0466719_184519 | 3300042606 | Bacteria | 2096 |
| 69 | Ga0466722_153535 | 3300042609 | Bacteria | 77080 |
| 70 | Ga0466722_215014 | 3300042609 | Bacteria | 2855 |
| 71 | Ga0123356_10638645 | 3300010049 | Bacteria | 1231 |
| 72 | Ga0123353_10292500 | 3300010167 | Unclassified | 2492 |
| 73 | Ga0123353_10589745 | 3300010167 | Bacteria | 1592 |
| 74 | Ga0123354_10067766 | 3300010882 | Bacteria | 5195 |
| 75 | Ga0123354_10122591 | 3300010882 | Bacteria | 3344 |
| 76 | Ga0466710_018618 | 3300042613 | Bacteria | 2063 |
| 77 | Ga0466711_163192 | 3300042615 | Unclassified | 1455 |
| 78 | Ga0466711_349590 | 3300042615 | Bacteria | 18476 |
| 79 | Ga0466715_184396 | 3300042616 | Bacteria | 9508 |
| 80 | Ga0466723_067547 | 3300042618 | Bacteria | 33416 |
| 81 | Ga0466723_220968 | 3300042618 | Bacteria | 17855 |
| 82 | Ga0466726_136404 | 3300042619 | Bacteria | 5964 |
| 83 | Ga0466728_008444 | 3300042620 | Bacteria | 7415 |
| 84 | Ga0466728_082257 | 3300042620 | Bacteria | 106309 |
| 85 | Ga0466728_119798 | 3300042620 | Bacteria | 9621 |
| 86 | Ga0466728_161504 | 3300042620 | Bacteria | 8639 |
| 87 | Ga0466728_250678 | 3300042620 | Bacteria | 1744 |
| 88 | 2227502694 | 2225789004 | Bacteria | 3762 |
| 89 | JGI24705J35276_12238770 | 3300002504 | Bacteria | 57808 |
| 90 | Ga0074310_1127771 | 3300005308 | Bacteria | 987 |
| 91 | Ga0102740_1000389 | 3300007140 | Bacteria | 12201 |
| 92 | Ga0466705_043861 | 3300042612 | Bacteria | 4071 |
| 93 | Ga0466705_293042 | 3300042612 | Bacteria | 3278 |
| 94 | Ga0466733_015946 | 3300042659 | Bacteria | 1447 |
| 95 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 96 | Ga0160457_1002934 | 3300012858 | Bacteria | 3220 |
| 97 | Ga0466690_043173 | 3300042590 | Bacteria | 2440 |
| 98 | Ga0466690_123123 | 3300042590 | Bacteria | 7505 |
| 99 | Ga0466690_399254 | 3300042590 | Bacteria | 15537 |
| 100 | Ga0466693_397260 | 3300042592 | Bacteria | 1661 |
| 101 | Ga0466695_271892 | 3300042595 | Bacteria | 2315 |
| 102 | Ga0466731_053728 | 3300042622 | Bacteria | 1076 |
| 103 | Ga0466724_20494 | 3300042649 | Unclassified | 3246 |
| 104 | Ga0466725_322869 | 3300042654 | Bacteria | 2131 |
| 105 | Ga0466727_113382 | 3300042655 | Bacteria | 14109 |
| 106 | Ga0466706_092580 | 3300042599 | Bacteria | 22600 |
| 107 | Ga0466707_396806 | 3300042601 | Bacteria | 5009 |
| 108 | Ga0466713_050816 | 3300042602 | Bacteria | 2163 |
| 109 | Ga0466713_079755 | 3300042602 | Bacteria | 6344 |
| 110 | Ga0466714_055065 | 3300042603 | Bacteria | 31938 |
| 111 | Ga0466716_417061 | 3300042605 | Bacteria | 6042 |
| 112 | Ga0466722_076138 | 3300042609 | Bacteria | 8581 |
| 113 | Ga0466722_248745 | 3300042609 | Bacteria | 8713 |
| 114 | Ga0123356_10185272 | 3300010049 | Bacteria | 2107 |
| 115 | Ga0123353_10601637 | 3300010167 | Bacteria | 1571 |
| 116 | Ga0466705_501359 | 3300042612 | Bacteria | 6673 |
| 117 | Ga0466711_017721 | 3300042615 | Bacteria | 11268 |
| 118 | Ga0466715_042405 | 3300042616 | Bacteria | 42589 |
| 119 | Ga0466723_127592 | 3300042618 | Bacteria | 4632 |
| 120 | Ga0466726_073989 | 3300042619 | Bacteria | 8511 |
| 121 | Ga0466726_321465 | 3300042619 | Bacteria | 5384 |
| 122 | Ga0466726_402517 | 3300042619 | Bacteria | 1586 |
| 123 | Ga0466729_120232 | 3300042621 | Bacteria | 7845 |
| 124 | IMNBL1DRAFT_c0001559 | 3300000062 | Bacteria | 17056 |
| 125 | JGI24702J35022_10024094 | 3300002462 | Bacteria | 3289 |
| 126 | Ga0068302_10066929 | 3300005071 | Unclassified | 1290 |
| 127 | Ga0466705_033490 | 3300042612 | Bacteria | 4230 |
| 128 | Ga0466705_245414 | 3300042612 | Bacteria | 3986 |
| 129 | Ga0466733_041321 | 3300042659 | Bacteria | 6661 |
| 130 | Ga0466733_177192 | 3300042659 | Bacteria | 4578 |
| 131 | Ga0160453_100317 | 3300012814 | Bacteria | 42491 |
| 132 | Ga0160469_104268 | 3300012824 | Bacteria | 1705 |
| 133 | Ga0160441_100048 | 3300012825 | Bacteria | 159162 |
| 134 | Ga0160433_100067 | 3300012846 | Bacteria | 112579 |
| 135 | Ga0160433_100862 | 3300012846 | Bacteria | 10612 |
| 136 | Ga0160448_100898 | 3300012854 | Bacteria | 10001 |
| 137 | Ga0160435_1000009 | 3300012857 | Bacteria | 251327 |
| 138 | Ga0466690_023177 | 3300042590 | Bacteria | 7338 |
| 139 | Ga0466696_163396 | 3300042596 | Bacteria | 31403 |
| 140 | Ga0466704_042883 | 3300042643 | Bacteria | 6579 |
| 141 | Ga0466724_62327 | 3300042649 | Bacteria | 25116 |
| 142 | Ga0466708_136612 | 3300042652 | Bacteria | 9002 |
| 143 | Ga0466725_138136 | 3300042654 | Bacteria | 17555 |
| 144 | Ga0466727_156109 | 3300042655 | Bacteria | 4426 |
| 145 | Ga0466700_105075 | 3300042600 | Bacteria | 3459 |
| 146 | Ga0466700_225864 | 3300042600 | Bacteria | 2184 |
| 147 | Ga0466714_072512 | 3300042603 | Bacteria | 4773 |
| 148 | Ga0466714_125951 | 3300042603 | Bacteria | 7817 |
| 149 | Ga0466714_139644 | 3300042603 | Bacteria | 2442 |
| 150 | Ga0466716_010048 | 3300042605 | Bacteria | 6581 |
| 151 | Ga0466716_063630 | 3300042605 | Bacteria | 19460 |
| 152 | Ga0466716_402274 | 3300042605 | Bacteria | 15032 |
| 153 | Ga0466719_159297 | 3300042606 | Bacteria | 1772 |
| 154 | Ga0466719_247241 | 3300042606 | Bacteria | 8263 |
| 155 | Ga0466722_197967 | 3300042609 | Bacteria | 15103 |
| 156 | Ga0466698_281978 | 3300042610 | Bacteria | 1371 |
| 157 | Ga0123354_10135930 | 3300010882 | Bacteria | 3074 |
| 158 | Ga0160454_100017 | 3300012798 | Bacteria | 326439 |
| 159 | Ga0466715_068634 | 3300042616 | Bacteria | 15808 |
| 160 | Ga0466723_283146 | 3300042618 | Bacteria | 2939 |
| 161 | Ga0466726_138636 | 3300042619 | Bacteria | 9691 |
| 162 | IMNBL1DRAFT_c0002516 | 3300000062 | Bacteria | 12694 |
| 163 | JGI24702J35022_10148547 | 3300002462 | Bacteria | 1313 |
| 164 | Ga0068305_10002943 | 3300005083 | Bacteria | 5877 |
| 165 | Ga0102734_1001581 | 3300007129 | Bacteria | 5635 |
| 166 | Ga0104042_1129566 | 3300007130 | Bacteria | 1028 |
| 167 | Ga0104050_1002335 | 3300007153 | Bacteria | 4674 |
| 168 | Ga0466733_001492 | 3300042659 | Bacteria | 15452 |
| 169 | Ga0466733_093650 | 3300042659 | Bacteria | 1353 |
| 170 | Ga0160444_101661 | 3300012841 | Bacteria | 3911 |
| 171 | Ga0466657_331422 | 3300042582 | Bacteria | 1035 |
| 172 | Ga0466730_053884 | 3300042625 | Bacteria | 416658 |
| 173 | Ga0466703_312756 | 3300042636 | Bacteria | 1182 |
| 174 | Ga0466703_367185 | 3300042636 | Bacteria | 1571 |
| 175 | Ga0466704_033765 | 3300042643 | Bacteria | 45083 |
| 176 | Ga0466709_184368 | 3300042648 | Bacteria | 5407 |
| 177 | Ga0466724_43696 | 3300042649 | Bacteria | 561295 |
| 178 | Ga0466708_082278 | 3300042652 | Bacteria | 15881 |
| 179 | Ga0466725_326763 | 3300042654 | Bacteria | 6695 |
| 180 | Ga0466706_123500 | 3300042599 | Bacteria | 65360 |
| 181 | Ga0466707_356295 | 3300042601 | Bacteria | 36922 |
| 182 | Ga0466713_031412 | 3300042602 | Bacteria | 2821 |
| 183 | Ga0466713_108742 | 3300042602 | Bacteria | 24178 |
| 184 | Ga0466713_117673 | 3300042602 | Bacteria | 10280 |
| 185 | Ga0466713_119093 | 3300042602 | Bacteria | 59442 |
| 186 | Ga0466714_006417 | 3300042603 | Bacteria | 6100 |
| 187 | Ga0466714_018993 | 3300042603 | Bacteria | 3387 |
| 188 | Ga0466714_130200 | 3300042603 | Unclassified | 8227 |
| 189 | Ga0466719_254644 | 3300042606 | Bacteria | 10238 |
| 190 | Ga0466722_023960 | 3300042609 | Bacteria | 61916 |
| 191 | Ga0123357_10260932 | 3300009784 | Bacteria | 1832 |
| 192 | Ga0123356_10030347 | 3300010049 | Bacteria | 5060 |
| 193 | Ga0123354_10662816 | 3300010882 | Bacteria | 741 |
| 194 | Ga0466705_405415 | 3300042612 | Unclassified | 1974 |
| 195 | Ga0466711_064702 | 3300042615 | Bacteria | 28145 |
| 196 | Ga0466711_512929 | 3300042615 | Bacteria | 34740 |
| 197 | Ga0466715_034572 | 3300042616 | Bacteria | 6195 |
| 198 | Ga0466723_307687 | 3300042618 | Bacteria | 24942 |
| 199 | Ga0466726_169279 | 3300042619 | Bacteria | 12980 |
| 200 | Ga0466729_031103 | 3300042621 | Bacteria | 19143 |
| 201 | JGI24705J35276_12217911 | 3300002504 | Bacteria | 2117 |
| 202 | Ga0105524_106387 | 3300007733 | Bacteria | 1695 |
| 203 | Ga0123357_10000477 | 3300009784 | Bacteria | 39043 |
| 204 | Ga0466705_071610 | 3300042612 | Bacteria | 13460 |
| 205 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 206 | Ga0160433_101031 | 3300012846 | Bacteria | 8872 |
| 207 | Ga0265387_1009046 | 3300024582 | Bacteria | 1343 |
| 208 | Ga0466690_140042 | 3300042590 | Bacteria | 6802 |
| 209 | Ga0466691_014655 | 3300042593 | Bacteria | 1867 |
| 210 | Ga0466696_041872 | 3300042596 | Bacteria | 15709 |
| 211 | Ga0466696_132213 | 3300042596 | Bacteria | 27642 |
| 212 | Ga0466735_064447 | 3300042624 | Bacteria | 1633 |
| 213 | Ga0466735_082758 | 3300042624 | Bacteria | 2819 |
| 214 | Ga0466735_143509 | 3300042624 | Bacteria | 3484 |
| 215 | Ga0466703_346976 | 3300042636 | Bacteria | 1718 |
| 216 | Ga0466704_334749 | 3300042643 | Bacteria | 2461 |
| 217 | Ga0466704_415480 | 3300042643 | Unclassified | 5704 |
| 218 | Ga0466709_164312 | 3300042648 | Bacteria | 3834 |
| 219 | Ga0466724_06704 | 3300042649 | Unclassified | 14772 |
| 220 | Ga0466708_271175 | 3300042652 | Bacteria | 49420 |
| 221 | Ga0466727_020731 | 3300042655 | Bacteria | 1680 |
| 222 | Ga0466727_074779 | 3300042655 | Bacteria | 10582 |
| 223 | Ga0466706_017930 | 3300042599 | Bacteria | 14971 |
| 224 | Ga0466706_126480 | 3300042599 | Bacteria | 6518 |
| 225 | Ga0466706_183553 | 3300042599 | Bacteria | 7734 |
| 226 | Ga0466707_197401 | 3300042601 | Bacteria | 10104 |
| 227 | Ga0466713_002210 | 3300042602 | Bacteria | 6334 |
| 228 | Ga0466713_045311 | 3300042602 | Bacteria | 10275 |
| 229 | Ga0466714_049792 | 3300042603 | Bacteria | 5284 |
| 230 | Ga0466714_092453 | 3300042603 | Bacteria | 62724 |
| 231 | Ga0466714_134138 | 3300042603 | Bacteria | 6392 |
| 232 | Ga0466716_185424 | 3300042605 | Bacteria | 3931 |
| 233 | Ga0466719_220957 | 3300042606 | Bacteria | 4850 |
| 234 | Ga0466719_332025 | 3300042606 | Unclassified | 1682 |
| 235 | Ga0466698_512251 | 3300042610 | Bacteria | 3211 |
| 236 | Ga0123355_10335701 | 3300009826 | Unclassified | 2019 |
| 237 | Ga0123353_10685325 | 3300010167 | Bacteria | 1442 |
| 238 | Ga0466711_151417 | 3300042615 | Bacteria | 13610 |
| 239 | Ga0466715_134828 | 3300042616 | Bacteria | 35442 |
| 240 | Ga0466715_172678 | 3300042616 | Bacteria | 13132 |
| 241 | Ga0466715_417848 | 3300042616 | Bacteria | 14069 |
| 242 | Ga0466715_644652 | 3300042616 | Bacteria | 7871 |
| 243 | Ga0466723_008142 | 3300042618 | Bacteria | 5108 |
| 244 | Ga0466723_041908 | 3300042618 | Bacteria | 6519 |
| 245 | 2227487708 | 2225789004 | Bacteria | 4188 |
| 246 | 2227546849 | 2225789004 | Bacteria | 15245 |
| 247 | IMNBL1DRAFT_c0000563 | 3300000062 | Bacteria | 29996 |
| 248 | JGI24702J35022_10000571 | 3300002462 | Bacteria | 22381 |
| 249 | JGI24702J35022_10000989 | 3300002462 | Bacteria | 17803 |
| 250 | JGI24702J35022_10014732 | 3300002462 | Bacteria | 4310 |
| 251 | CVPL010W_10001210 | 3300002931 | Bacteria | 29766 |
| 252 | Ga0068302_10058125 | 3300005071 | Bacteria | 4358 |
| 253 | Ga0068305_10006683 | 3300005083 | Bacteria | 6701 |
| 254 | Ga0068305_10038207 | 3300005083 | Bacteria | 6258 |
| 255 | Ga0466705_108618 | 3300042612 | Bacteria | 8409 |
| 256 | Ga0466705_185303 | 3300042612 | Unclassified | 4319 |
| 257 | Ga0466733_019680 | 3300042659 | Bacteria | 3681 |
| 258 | Ga0466733_168571 | 3300042659 | Bacteria | 14566 |
| 259 | Ga0160468_100065 | 3300012819 | Bacteria | 140978 |
| 260 | Ga0160445_100268 | 3300012847 | Bacteria | 35665 |
| 261 | Ga0160457_1000010 | 3300012858 | Bacteria | 500717 |
| 262 | Ga0466690_163724 | 3300042590 | Bacteria | 2944 |
| 263 | Ga0466690_201454 | 3300042590 | Bacteria | 6429 |
| 264 | Ga0466690_268790 | 3300042590 | Bacteria | 12537 |
| 265 | Ga0466690_330545 | 3300042590 | Bacteria | 2356 |
| 266 | Ga0466691_204797 | 3300042593 | Bacteria | 11035 |
| 267 | Ga0466696_191370 | 3300042596 | Bacteria | 13083 |
| 268 | Ga0466696_385766 | 3300042596 | Bacteria | 51576 |
| 269 | Ga0466696_430997 | 3300042596 | Bacteria | 10200 |
| 270 | Ga0466735_206315 | 3300042624 | Bacteria | 1484 |
| 271 | Ga0466735_228558 | 3300042624 | Bacteria | 13908 |
| 272 | Ga0466730_026512 | 3300042625 | Bacteria | 4014 |
| 273 | Ga0466703_063178 | 3300042636 | Bacteria | 4716 |
| 274 | Ga0466703_124801 | 3300042636 | Bacteria | 6492 |
| 275 | Ga0466703_322230 | 3300042636 | Bacteria | 13191 |
| 276 | Ga0466727_143727 | 3300042655 | Bacteria | 2177 |
| 277 | Ga0466706_028017 | 3300042599 | Bacteria | 30169 |
| 278 | Ga0466706_108075 | 3300042599 | Unclassified | 3202 |
| 279 | Ga0466706_141746 | 3300042599 | Bacteria | 3266 |
| 280 | Ga0466706_192668 | 3300042599 | Bacteria | 87404 |
| 281 | Ga0466707_004626 | 3300042601 | Bacteria | 1320 |
| 282 | Ga0466707_026946 | 3300042601 | Bacteria | 1790 |
| 283 | Ga0466713_077258 | 3300042602 | Bacteria | 51427 |
| 284 | Ga0466713_114403 | 3300042602 | Bacteria | 19166 |
| 285 | Ga0466713_148784 | 3300042602 | Bacteria | 1147 |
| 286 | Ga0466714_089055 | 3300042603 | Bacteria | 9374 |
| 287 | Ga0466714_099555 | 3300042603 | Bacteria | 2723 |
| 288 | Ga0466717_144887 | 3300042604 | Bacteria | 2060 |
| 289 | Ga0466719_189528 | 3300042606 | Bacteria | 6438 |
| 290 | Ga0466722_053445 | 3300042609 | Bacteria | 38463 |
| 291 | Ga0466722_173968 | 3300042609 | Bacteria | 9697 |
| 292 | Ga0123356_10008918 | 3300010049 | Unclassified | 9928 |
| 293 | Ga0123356_10474470 | 3300010049 | Bacteria | 1403 |
| 294 | Ga0123356_11771812 | 3300010049 | Bacteria | 767 |
| 295 | Ga0466715_282493 | 3300042616 | Bacteria | 19731 |
| 296 | Ga0466718_130299 | 3300042617 | Bacteria | 1556 |
| 297 | Ga0466728_065619 | 3300042620 | Bacteria | 98744 |
| 298 | JGI24699J35502_11134214 | 3300002509 | Bacteria | 63548 |
| 299 | Ga0466705_135278 | 3300042612 | Bacteria | 5393 |
| 300 | Ga0466705_300881 | 3300042612 | Bacteria | 3716 |
| 301 | Ga0466705_322290 | 3300042612 | Bacteria | 30179 |
| 302 | Ga0466705_381531 | 3300042612 | Bacteria | 5084 |
| 303 | Ga0466705_386930 | 3300042612 | Bacteria | 1216 |
| 304 | Ga0160452_100806 | 3300012834 | Bacteria | 13737 |
| 305 | Ga0466657_044718 | 3300042582 | Bacteria | 106729 |
| 306 | Ga0466690_085121 | 3300042590 | Bacteria | 17010 |
| 307 | Ga0466692_175154 | 3300042591 | Bacteria | 1728 |
| 308 | Ga0466691_108306 | 3300042593 | Bacteria | 22700 |
| 309 | Ga0466694_155458 | 3300042594 | Bacteria | 2247 |
| 310 | Ga0466696_333876 | 3300042596 | Bacteria | 1320 |
| 311 | Ga0466703_304922 | 3300042636 | Bacteria | 2076 |
| 312 | Ga0466703_382072 | 3300042636 | Bacteria | 3683 |
| 313 | Ga0466703_401461 | 3300042636 | Bacteria | 5219 |
| 314 | Ga0466704_033462 | 3300042643 | Bacteria | 12320 |
| 315 | Ga0466709_169139 | 3300042648 | Bacteria | 148698 |
| 316 | Ga0466708_013019 | 3300042652 | Bacteria | 32676 |
| 317 | Ga0466708_021491 | 3300042652 | Bacteria | 16046 |
| 318 | Ga0466725_005820 | 3300042654 | Bacteria | 1266 |
| 319 | Ga0466727_095447 | 3300042655 | Bacteria | 23337 |
| 320 | Ga0466706_216083 | 3300042599 | Bacteria | 1409 |
| 321 | Ga0466700_156172 | 3300042600 | Bacteria | 109805 |
| 322 | Ga0466713_036309 | 3300042602 | Bacteria | 22318 |
| 323 | Ga0466713_096871 | 3300042602 | Bacteria | 7429 |
| 324 | Ga0466714_056675 | 3300042603 | Bacteria | 3289 |
| 325 | Ga0466714_138772 | 3300042603 | Bacteria | 3689 |
| 326 | Ga0466716_060951 | 3300042605 | Bacteria | 11397 |
| 327 | Ga0466722_187680 | 3300042609 | Bacteria | 5133 |
| 328 | Ga0466722_193977 | 3300042609 | Bacteria | 15796 |
| 329 | Ga0466722_201253 | 3300042609 | Bacteria | 5790 |
| 330 | Ga0466722_219092 | 3300042609 | Bacteria | 2045 |
| 331 | Ga0123356_10186007 | 3300010049 | Bacteria | 2103 |
| 332 | Ga0123356_10727005 | 3300010049 | Bacteria | 1162 |
| 333 | Ga0123353_10255061 | 3300010167 | Bacteria | 2713 |
| 334 | Ga0123353_10398627 | 3300010167 | Bacteria | 2049 |
| 335 | Ga0466711_093181 | 3300042615 | Bacteria | 1589 |
| 336 | Ga0466715_133026 | 3300042616 | Bacteria | 6833 |
| 337 | Ga0466723_351001 | 3300042618 | Bacteria | 49966 |
| 338 | Ga0466726_015725 | 3300042619 | Bacteria | 3079 |
| 339 | Ga0466726_239224 | 3300042619 | Bacteria | 4646 |
| 340 | Ga0466728_093166 | 3300042620 | Bacteria | 80427 |
| 341 | Ga0466728_360793 | 3300042620 | Bacteria | 2816 |
| 342 | Ga0466728_399272 | 3300042620 | Bacteria | 209367 |
| 343 | Ga0466729_079948 | 3300042621 | Bacteria | 4320 |
| 344 | IMNBL1DRAFT_c0008477 | 3300000062 | Bacteria | 5225 |
| 345 | Ga0068305_10181865 | 3300005083 | Bacteria | 3098 |
| 346 | Ga0072941_1151003 | 3300005201 | Bacteria | 5393 |
| 347 | Ga0103267_1000286 | 3300007190 | Bacteria | 18080 |
| 348 | Ga0103267_1000804 | 3300007190 | Bacteria | 13077 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04298 | Zn_peptidase_2 | Putative neutral zinc metallopeptidase | 43 | 260 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.