Protein Family IF06097

Metagenome Isolate
311 Members
112 Samples
249 Scaffolds
263.87 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_081773|Ga0466713_081773_16845_17750
Length
301 aa
Sequence
VCPDKLISKFENMPMCQLAQSDLFQIFKFSNQQIKNIMQNQFSLNGKIALVTGASYGIGFAIASALAEAGATIVFNDLKQEFVDKGLAAYKEAGIAANGYVCDVTNEDQVNAMVARIEKEVGVIDILVNNAGIIKRVPMHEMPAAEFRQVIDVDLNAPFIVSKAVLPSMMKKRAGKIINICSMMSELGRETVSAYAAAKGGLKMLTRNIASEYGEYNIQCNGIGPGYIATPQTAPLREPQADGSRHPFDSFIIAKTPAARWGNPEDLSGPAVFLASNASDFVNGHVLYVDGGILAYIGKQP

πŸ“Š Sample Types

Isolate 19.9%
Metagenome 80.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Blattidae 20.6%
Termitidae 19.6%
Unclassified 14.7%
Kalotermitidae 13.7%
Apidae 8.8%
Rhinotermitidae 5.9%
Termopsidae 2.9%
Formicidae 2.0%
Hydrophilidae 2.0%
Passalidae 2.0%
Tenebrionidae 2.0%
Gomphidae 1.0%
Libellulidae 1.0%
Drosophilidae 1.0%
Scarabaeidae 1.0%
Bombycidae 1.0%
Hodotermitidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 294
Eukaryota 0
Viruses 0
Unclassified 17

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
2 2595698195 Melissococcus plutonius 119 Isolate Apidae
3 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300007901 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii Metagenome Formicidae
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 8007223943 Enterococcus sp. MSG2901 Isolate
8 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
9 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
10 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
11 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
12 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
13 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
14 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
15 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
16 2595698197 Melissococcus plutonius H6 Isolate Apidae
17 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
18 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
19 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
20 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
21 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
22 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
23 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
28 2595698199 Melissococcus plutonius 60 Isolate Apidae
29 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
30 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
31 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
32 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
33 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
34 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
35 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
40 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
41 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
42 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
43 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
44 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
45 2595698198 Melissococcus plutonius L9 Isolate Apidae
46 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
47 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
48 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
49 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
50 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
51 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
52 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
53 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
54 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
55 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
56 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
57 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
58 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
59 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
60 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
61 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
62 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
63 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
64 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
65 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
66 8108568626 Enterococcus sp. DIV1094 Isolate
67 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
68 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
69 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
70 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
71 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
72 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
73 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
74 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
75 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
76 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
77 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
78 2627853628 Melissococcus plutonius 82 Isolate Apidae
79 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
80 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
81 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
82 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
83 8114555646 Enterococcus sp. DIV1094 Isolate
84 2593339125 Clostridium sp. 5 Isolate Termitidae
85 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
86 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
87 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
88 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
89 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
90 2590828839 Clostridium sp. 1 Isolate Termitidae
91 2595698193 Melissococcus plutonius B5 Isolate Apidae
92 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
93 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
94 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
95 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
96 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
97 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
98 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
99 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
100 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
101 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
102 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
103 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
104 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
105 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
106 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
107 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
108 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
109 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
110 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
111 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
112 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_039947 3300042612 Bacteria 5133
2 Ga0466705_114757 3300042612 Bacteria 6263
3 Ga0466733_199948 3300042659 Bacteria 1007
4 Ga0530661_000026 3300056564 Bacteria 182176
5 Ga0562375_0762 3300056856 Unclassified 56268
6 Ga0466692_021026 3300042591 Bacteria 1562
7 Ga0466692_032038 3300042591 Bacteria 11564
8 Ga0466692_167262 3300042591 Bacteria 7173
9 Ga0466696_007503 3300042596 Bacteria 10728
10 Ga0466701_007688 3300042598 Bacteria 9495
11 Ga0466723_125880 3300042618 Bacteria 16503
12 Ga0466723_374588 3300042618 Bacteria 41739
13 Ga0466726_371359 3300042619 Bacteria 11043
14 Ga0466726_418244 3300042619 Bacteria 2702
15 Ga0466706_040043 3300042599 Unclassified 6841
16 Ga0466706_175169 3300042599 Bacteria 2708
17 Ga0466706_261211 3300042599 Bacteria 1233
18 Ga0466707_006318 3300042601 Bacteria 1997
19 Ga0466707_009633 3300042601 Bacteria 35190
20 Ga0466707_108461 3300042601 Unclassified 2823
21 Ga0466707_298811 3300042601 Bacteria 5888
22 Ga0466714_013987 3300042603 Bacteria 17182
23 Ga0466714_125121 3300042603 Bacteria 6005
24 Ga0466698_380448 3300042610 Bacteria 6973
25 Ga0466729_262127 3300042621 Bacteria 2976
26 Ga0466703_348360 3300042636 Bacteria 3638
27 Ga0466704_036765 3300042643 Bacteria 16967
28 Ga0466708_164096 3300042652 Bacteria 7334
29 Ga0466725_226736 3300042654 Bacteria 7622
30 Ga0466727_107509 3300042655 Bacteria 1137
31 Ga0466727_150110 3300042655 Bacteria 20444
32 2227485756 2225789004 Bacteria 21150
33 IMNBL1DRAFT_c0001847 3300000062 Bacteria 15421
34 Ga0466697_064703 3300042611 Bacteria 1114
35 Ga0466705_059654 3300042612 Bacteria 2020
36 Ga0466705_249902 3300042612 Bacteria 9089
37 Ga0466691_226692 3300042593 Bacteria 4013
38 Ga0466695_115734 3300042595 Unclassified 2175
39 Ga0466696_161386 3300042596 Bacteria 1644
40 Ga0123355_10001621 3300009826 Bacteria 31414
41 Ga0123354_10333019 3300010882 Bacteria 1381
42 Ga0466715_034348 3300042616 Bacteria 8033
43 Ga0466715_173113 3300042616 Unclassified 16038
44 Ga0466715_210789 3300042616 Bacteria 2479
45 Ga0466715_352922 3300042616 Bacteria 9079
46 Ga0466729_071081 3300042621 Bacteria 1535
47 Ga0466729_100099 3300042621 Bacteria 4848
48 Ga0466706_140343 3300042599 Bacteria 15711
49 Ga0466707_238767 3300042601 Bacteria 7067
50 Ga0466713_020921 3300042602 Bacteria 109196
51 Ga0466713_089403 3300042602 Bacteria 3762
52 Ga0466713_099472 3300042602 Bacteria 53957
53 Ga0466713_134320 3300042602 Bacteria 10928
54 Ga0466714_007733 3300042603 Bacteria 2153
55 Ga0466719_123558 3300042606 Bacteria 7267
56 Ga0466719_156952 3300042606 Unclassified 4658
57 Ga0466722_055264 3300042609 Bacteria 8801
58 Ga0466729_246079 3300042621 Bacteria 4856
59 Ga0466703_130753 3300042636 Bacteria 9893
60 Ga0466703_363460 3300042636 Bacteria 6662
61 Ga0466704_338397 3300042643 Bacteria 2524
62 Ga0466704_588482 3300042643 Bacteria 11572
63 Ga0466709_001118 3300042648 Bacteria 49895
64 Ga0466708_056254 3300042652 Bacteria 11846
65 Ga0466727_336519 3300042655 Bacteria 43046
66 2227463005 2225789004 Bacteria 999
67 Ga0068305_10049092 3300005083 Bacteria 12491
68 Ga0068305_10084863 3300005083 Unclassified 13032
69 Ga0072940_1198178 3300005200 Bacteria 1844
70 Ga0466705_243931 3300042612 Bacteria 5436
71 Ga0466733_086235 3300042659 Bacteria 57120
72 Ga0255575_1000121 3300026559 Bacteria 59640
73 Ga0466690_198924 3300042590 Bacteria 34985
74 Ga0466690_215880 3300042590 Bacteria 1807
75 Ga0466692_102977 3300042591 Bacteria 2615
76 Ga0466696_189901 3300042596 Bacteria 10950
77 Ga0466696_197521 3300042596 Bacteria 1690
78 Ga0466696_420828 3300042596 Bacteria 12974
79 Ga0123354_10223030 3300010882 Bacteria 1996
80 Ga0466711_178553 3300042615 Bacteria 5412
81 Ga0466715_005856 3300042616 Bacteria 5612
82 Ga0466726_235591 3300042619 Bacteria 2087
83 Ga0466728_198023 3300042620 Bacteria 9140
84 Ga0466706_047605 3300042599 Bacteria 73987
85 Ga0466706_098336 3300042599 Bacteria 9784
86 Ga0466706_256844 3300042599 Bacteria 1378
87 Ga0466713_144823 3300042602 Bacteria 7695
88 Ga0466714_053149 3300042603 Bacteria 4792
89 Ga0466716_147451 3300042605 Bacteria 22878
90 Ga0466698_099139 3300042610 Bacteria 3608
91 Ga0466729_301768 3300042621 Bacteria 1660
92 Ga0466735_009894 3300042624 Bacteria 1715
93 Ga0466703_024287 3300042636 Bacteria 29560
94 Ga0466703_043437 3300042636 Bacteria 8263
95 Ga0466703_045817 3300042636 Bacteria 8507
96 Ga0466703_390239 3300042636 Bacteria 3060
97 Ga0466704_210888 3300042643 Bacteria 37471
98 Ga0466725_259712 3300042654 Bacteria 12556
99 Ga0466727_133513 3300042655 Unclassified 6106
100 Ga0068305_10001223 3300005083 Bacteria 98255
101 Ga0068305_10004897 3300005083 Bacteria 77977
102 Ga0466705_066162 3300042612 Bacteria 7565
103 Ga0466705_178773 3300042612 Unclassified 4424
104 Ga0466733_050679 3300042659 Bacteria 1118
105 Ga0466733_061998 3300042659 Bacteria 12301
106 Ga0466733_208167 3300042659 Bacteria 31218
107 Ga0265387_1012875 3300024582 Bacteria 1162
108 Ga0466690_011526 3300042590 Bacteria 10291
109 Ga0466690_033991 3300042590 Bacteria 11426
110 Ga0466691_082783 3300042593 Bacteria 28065
111 Ga0466696_254406 3300042596 Bacteria 1600
112 Ga0466712_086954 3300042614 Bacteria 4381
113 Ga0466715_056569 3300042616 Bacteria 35867
114 Ga0466728_229448 3300042620 Bacteria 12851
115 Ga0466728_283835 3300042620 Bacteria 1460
116 Ga0466729_053361 3300042621 Bacteria 1782
117 Ga0466701_037271 3300042598 Bacteria 8889
118 Ga0466706_034191 3300042599 Bacteria 44289
119 Ga0466706_102385 3300042599 Bacteria 3356
120 Ga0466707_125490 3300042601 Bacteria 17968
121 Ga0466707_306154 3300042601 Bacteria 2976
122 Ga0466707_413602 3300042601 Bacteria 12802
123 Ga0466713_068845 3300042602 Bacteria 14438
124 Ga0466714_050410 3300042603 Bacteria 40060
125 Ga0466714_053919 3300042603 Bacteria 1473
126 Ga0466716_001967 3300042605 Bacteria 7332
127 Ga0466716_120424 3300042605 Bacteria 2823
128 Ga0466722_207055 3300042609 Bacteria 10529
129 Ga0466735_064587 3300042624 Bacteria 3911
130 Ga0466735_110848 3300042624 Bacteria 2689
131 Ga0466735_147323 3300042624 Bacteria 1383
132 Ga0466730_020228 3300042625 Bacteria 2512
133 Ga0466703_126526 3300042636 Bacteria 24961
134 Ga0466703_211551 3300042636 Bacteria 10631
135 Ga0466704_599784 3300042643 Bacteria 1191
136 Ga0466709_301311 3300042648 Bacteria 10280
137 Ga0466727_347312 3300042655 Bacteria 1589
138 Ga0466705_093655 3300042612 Bacteria 5923
139 Ga0466690_169321 3300042590 Bacteria 11225
140 Ga0466696_082907 3300042596 Bacteria 4944
141 Ga0123353_10164665 3300010167 Bacteria 3526
142 Ga0466711_000153 3300042615 Bacteria 14641
143 Ga0466711_302388 3300042615 Bacteria 1697
144 Ga0466715_592687 3300042616 Bacteria 16089
145 Ga0466723_034331 3300042618 Bacteria 16866
146 Ga0466706_043422 3300042599 Bacteria 9584
147 Ga0466706_047496 3300042599 Bacteria 8216
148 Ga0466706_072928 3300042599 Bacteria 51016
149 Ga0466706_151415 3300042599 Bacteria 14671
150 Ga0466713_064405 3300042602 Bacteria 152501
151 Ga0466713_085321 3300042602 Bacteria 16713
152 Ga0466713_156423 3300042602 Bacteria 30043
153 Ga0466714_001526 3300042603 Bacteria 10345
154 Ga0466716_080052 3300042605 Unclassified 5231
155 Ga0466719_189344 3300042606 Bacteria 3940
156 Ga0466735_005618 3300042624 Bacteria 2733
157 Ga0466735_191572 3300042624 Bacteria 1073
158 Ga0466703_189726 3300042636 Bacteria 7543
159 Ga0466704_236841 3300042643 Bacteria 15017
160 Ga0466704_250285 3300042643 Bacteria 39361
161 Ga0466708_023581 3300042652 Bacteria 13912
162 Ga0466727_047170 3300042655 Bacteria 83253
163 Ga0466727_248193 3300042655 Bacteria 2215
164 JGI24702J35022_10011405 3300002462 Bacteria 4952
165 Ga0466705_080417 3300042612 Bacteria 11609
166 Ga0466705_253431 3300042612 Unclassified 7940
167 Ga0466733_022670 3300042659 Bacteria 13341
168 Ga0466733_097847 3300042659 Bacteria 1332
169 Ga0456237_0000449 3300041968 Bacteria 6230
170 Ga0466692_048797 3300042591 Bacteria 3122
171 Ga0466691_073130 3300042593 Bacteria 4948
172 Ga0123353_10003728 3300010167 Bacteria 19388
173 Ga0466715_043956 3300042616 Bacteria 8106
174 Ga0466723_224156 3300042618 Bacteria 7701
175 Ga0466729_193452 3300042621 Bacteria 5886
176 Ga0466707_322791 3300042601 Bacteria 29199
177 Ga0466713_075457 3300042602 Bacteria 24128
178 Ga0466713_081773 3300042602 Bacteria 94516
179 Ga0466713_129444 3300042602 Bacteria 20978
180 Ga0466714_037174 3300042603 Bacteria 1169
181 Ga0466714_050845 3300042603 Bacteria 2580
182 Ga0466717_280830 3300042604 Bacteria 7600
183 Ga0466716_405180 3300042605 Bacteria 6795
184 Ga0466722_190419 3300042609 Bacteria 4542
185 Ga0466735_036712 3300042624 Bacteria 2329
186 Ga0466703_183704 3300042636 Bacteria 3343
187 IMNBL1DRAFT_c0002869 3300000062 Bacteria 11558
188 JGI24705J35276_12235834 3300002504 Bacteria 7035
189 Ga0111035_100153 3300007901 Bacteria 72026
190 Ga0466705_164418 3300042612 Unclassified 15010
191 Ga0466705_342178 3300042612 Bacteria 42153
192 Ga0466733_150891 3300042659 Bacteria 9991
193 Ga0466733_189028 3300042659 Bacteria 5746
194 Ga0466690_022508 3300042590 Bacteria 6990
195 Ga0466696_036786 3300042596 Bacteria 23414
196 Ga0123355_10003310 3300009826 Bacteria 23053
197 Ga0123355_10521440 3300009826 Bacteria 1454
198 Ga0466711_055238 3300042615 Bacteria 16327
199 Ga0466715_038292 3300042616 Bacteria 5020
200 Ga0466715_083165 3300042616 Bacteria 15895
201 Ga0466726_273015 3300042619 Bacteria 1891
202 Ga0466728_425802 3300042620 Bacteria 19622
203 Ga0466706_017038 3300042599 Bacteria 50770
204 Ga0466706_118499 3300042599 Bacteria 1691
205 Ga0466706_129856 3300042599 Bacteria 1084
206 Ga0466706_259005 3300042599 Unclassified 2210
207 Ga0466707_214516 3300042601 Bacteria 111790
208 Ga0466707_281968 3300042601 Bacteria 3448
209 Ga0466707_355096 3300042601 Bacteria 3298
210 Ga0466713_051493 3300042602 Bacteria 38137
211 Ga0466713_100528 3300042602 Bacteria 510720
212 Ga0466714_057554 3300042603 Bacteria 76415
213 Ga0466714_106812 3300042603 Bacteria 1957
214 Ga0466716_015109 3300042605 Unclassified 3054
215 Ga0466719_504944 3300042606 Bacteria 2660
216 Ga0466735_203242 3300042624 Bacteria 13594
217 Ga0466709_101021 3300042648 Unclassified 13453
218 Ga0466727_010719 3300042655 Bacteria 5533
219 Ga0466727_107621 3300042655 Bacteria 9293
220 Ga0466727_312918 3300042655 Bacteria 3496
221 2227425252 2225789004 Unclassified 5599
222 Ga0072941_1214418 3300005201 Bacteria 7131
223 Ga0466733_095282 3300042659 Bacteria 5457
224 Ga0466733_182643 3300042659 Unclassified 5662
225 Ga0466733_200633 3300042659 Bacteria 7367
226 Ga0562375_0091 3300056856 Bacteria 283318
227 Ga0466690_023436 3300042590 Bacteria 9478
228 Ga0466691_183265 3300042593 Bacteria 11148
229 Ga0466694_202319 3300042594 Bacteria 4666
230 Ga0466696_178696 3300042596 Bacteria 8383
231 Ga0466696_208836 3300042596 Bacteria 44609
232 Ga0123355_10000182 3300009826 Bacteria 77682
233 Ga0466711_135365 3300042615 Bacteria 14177
234 Ga0466711_225552 3300042615 Bacteria 18887
235 Ga0466711_326802 3300042615 Bacteria 7274
236 Ga0466711_343215 3300042615 Bacteria 7862
237 Ga0466715_018494 3300042616 Bacteria 8984
238 Ga0466715_607828 3300042616 Bacteria 77672
239 Ga0466707_144426 3300042601 Bacteria 7010
240 Ga0466707_262352 3300042601 Bacteria 9976
241 Ga0466719_079794 3300042606 Bacteria 11280
242 Ga0466719_342207 3300042606 Bacteria 10888
243 Ga0466722_262403 3300042609 Bacteria 1760
244 Ga0466703_071422 3300042636 Bacteria 20891
245 Ga0466703_175205 3300042636 Bacteria 25111
246 Ga0466704_045996 3300042643 Bacteria 2444
247 Ga0466704_147742 3300042643 Bacteria 15020
248 Ga0466709_169723 3300042648 Bacteria 216757
249 Ga0466727_100129 3300042655 Bacteria 2353

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00106 adh_short short chain dehydrogenase 47 239 0.99
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 53 293 0.93
PF08659 KR KR domain 50 202 0.9
PF23441 47 230 0.89

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.