Protein Family IF06097
Metagenome
Isolate
311
Members
112
Samples
249
Scaffolds
263.87
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_081773|Ga0466713_081773_16845_17750
- Length
- 301 aa
- Sequence
- VCPDKLISKFENMPMCQLAQSDLFQIFKFSNQQIKNIMQNQFSLNGKIALVTGASYGIGFAIASALAEAGATIVFNDLKQEFVDKGLAAYKEAGIAANGYVCDVTNEDQVNAMVARIEKEVGVIDILVNNAGIIKRVPMHEMPAAEFRQVIDVDLNAPFIVSKAVLPSMMKKRAGKIINICSMMSELGRETVSAYAAAKGGLKMLTRNIASEYGEYNIQCNGIGPGYIATPQTAPLREPQADGSRHPFDSFIIAKTPAARWGNPEDLSGPAVFLASNASDFVNGHVLYVDGGILAYIGKQP
Sample Types
Isolate
19.9%
Metagenome
80.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
20.6%
Termitidae
19.6%
Unclassified
14.7%
Kalotermitidae
13.7%
Apidae
8.8%
Rhinotermitidae
5.9%
Termopsidae
2.9%
Formicidae
2.0%
Hydrophilidae
2.0%
Passalidae
2.0%
Tenebrionidae
2.0%
Gomphidae
1.0%
Libellulidae
1.0%
Drosophilidae
1.0%
Scarabaeidae
1.0%
Bombycidae
1.0%
Hodotermitidae
1.0%
Taxonomy
Archaea
0
Bacteria
294
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 2 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 3 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300007901 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii | Metagenome | Formicidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 8 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 9 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 10 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 13 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 14 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 17 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 18 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 19 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 20 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 21 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 22 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 23 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 28 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 29 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 30 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 31 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 32 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 33 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 34 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 35 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 36 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 41 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 46 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 47 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 48 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 49 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 50 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 51 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 52 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 53 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 54 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 55 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 56 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 57 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 58 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 59 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 60 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 61 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 62 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 63 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 64 | 3300026559 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 | Metagenome | Formicidae |
| 65 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 66 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 67 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 68 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 69 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 70 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 71 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 72 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 73 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 74 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 75 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 76 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 77 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 78 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 79 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 80 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 81 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 82 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 83 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 84 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 85 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 86 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 87 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 88 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 89 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 90 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 91 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 92 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 93 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 94 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 95 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 96 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 97 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 98 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 99 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 100 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 101 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 102 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 103 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 104 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 105 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 106 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 107 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 108 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 109 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 110 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 111 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 112 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_039947 | 3300042612 | Bacteria | 5133 |
| 2 | Ga0466705_114757 | 3300042612 | Bacteria | 6263 |
| 3 | Ga0466733_199948 | 3300042659 | Bacteria | 1007 |
| 4 | Ga0530661_000026 | 3300056564 | Bacteria | 182176 |
| 5 | Ga0562375_0762 | 3300056856 | Unclassified | 56268 |
| 6 | Ga0466692_021026 | 3300042591 | Bacteria | 1562 |
| 7 | Ga0466692_032038 | 3300042591 | Bacteria | 11564 |
| 8 | Ga0466692_167262 | 3300042591 | Bacteria | 7173 |
| 9 | Ga0466696_007503 | 3300042596 | Bacteria | 10728 |
| 10 | Ga0466701_007688 | 3300042598 | Bacteria | 9495 |
| 11 | Ga0466723_125880 | 3300042618 | Bacteria | 16503 |
| 12 | Ga0466723_374588 | 3300042618 | Bacteria | 41739 |
| 13 | Ga0466726_371359 | 3300042619 | Bacteria | 11043 |
| 14 | Ga0466726_418244 | 3300042619 | Bacteria | 2702 |
| 15 | Ga0466706_040043 | 3300042599 | Unclassified | 6841 |
| 16 | Ga0466706_175169 | 3300042599 | Bacteria | 2708 |
| 17 | Ga0466706_261211 | 3300042599 | Bacteria | 1233 |
| 18 | Ga0466707_006318 | 3300042601 | Bacteria | 1997 |
| 19 | Ga0466707_009633 | 3300042601 | Bacteria | 35190 |
| 20 | Ga0466707_108461 | 3300042601 | Unclassified | 2823 |
| 21 | Ga0466707_298811 | 3300042601 | Bacteria | 5888 |
| 22 | Ga0466714_013987 | 3300042603 | Bacteria | 17182 |
| 23 | Ga0466714_125121 | 3300042603 | Bacteria | 6005 |
| 24 | Ga0466698_380448 | 3300042610 | Bacteria | 6973 |
| 25 | Ga0466729_262127 | 3300042621 | Bacteria | 2976 |
| 26 | Ga0466703_348360 | 3300042636 | Bacteria | 3638 |
| 27 | Ga0466704_036765 | 3300042643 | Bacteria | 16967 |
| 28 | Ga0466708_164096 | 3300042652 | Bacteria | 7334 |
| 29 | Ga0466725_226736 | 3300042654 | Bacteria | 7622 |
| 30 | Ga0466727_107509 | 3300042655 | Bacteria | 1137 |
| 31 | Ga0466727_150110 | 3300042655 | Bacteria | 20444 |
| 32 | 2227485756 | 2225789004 | Bacteria | 21150 |
| 33 | IMNBL1DRAFT_c0001847 | 3300000062 | Bacteria | 15421 |
| 34 | Ga0466697_064703 | 3300042611 | Bacteria | 1114 |
| 35 | Ga0466705_059654 | 3300042612 | Bacteria | 2020 |
| 36 | Ga0466705_249902 | 3300042612 | Bacteria | 9089 |
| 37 | Ga0466691_226692 | 3300042593 | Bacteria | 4013 |
| 38 | Ga0466695_115734 | 3300042595 | Unclassified | 2175 |
| 39 | Ga0466696_161386 | 3300042596 | Bacteria | 1644 |
| 40 | Ga0123355_10001621 | 3300009826 | Bacteria | 31414 |
| 41 | Ga0123354_10333019 | 3300010882 | Bacteria | 1381 |
| 42 | Ga0466715_034348 | 3300042616 | Bacteria | 8033 |
| 43 | Ga0466715_173113 | 3300042616 | Unclassified | 16038 |
| 44 | Ga0466715_210789 | 3300042616 | Bacteria | 2479 |
| 45 | Ga0466715_352922 | 3300042616 | Bacteria | 9079 |
| 46 | Ga0466729_071081 | 3300042621 | Bacteria | 1535 |
| 47 | Ga0466729_100099 | 3300042621 | Bacteria | 4848 |
| 48 | Ga0466706_140343 | 3300042599 | Bacteria | 15711 |
| 49 | Ga0466707_238767 | 3300042601 | Bacteria | 7067 |
| 50 | Ga0466713_020921 | 3300042602 | Bacteria | 109196 |
| 51 | Ga0466713_089403 | 3300042602 | Bacteria | 3762 |
| 52 | Ga0466713_099472 | 3300042602 | Bacteria | 53957 |
| 53 | Ga0466713_134320 | 3300042602 | Bacteria | 10928 |
| 54 | Ga0466714_007733 | 3300042603 | Bacteria | 2153 |
| 55 | Ga0466719_123558 | 3300042606 | Bacteria | 7267 |
| 56 | Ga0466719_156952 | 3300042606 | Unclassified | 4658 |
| 57 | Ga0466722_055264 | 3300042609 | Bacteria | 8801 |
| 58 | Ga0466729_246079 | 3300042621 | Bacteria | 4856 |
| 59 | Ga0466703_130753 | 3300042636 | Bacteria | 9893 |
| 60 | Ga0466703_363460 | 3300042636 | Bacteria | 6662 |
| 61 | Ga0466704_338397 | 3300042643 | Bacteria | 2524 |
| 62 | Ga0466704_588482 | 3300042643 | Bacteria | 11572 |
| 63 | Ga0466709_001118 | 3300042648 | Bacteria | 49895 |
| 64 | Ga0466708_056254 | 3300042652 | Bacteria | 11846 |
| 65 | Ga0466727_336519 | 3300042655 | Bacteria | 43046 |
| 66 | 2227463005 | 2225789004 | Bacteria | 999 |
| 67 | Ga0068305_10049092 | 3300005083 | Bacteria | 12491 |
| 68 | Ga0068305_10084863 | 3300005083 | Unclassified | 13032 |
| 69 | Ga0072940_1198178 | 3300005200 | Bacteria | 1844 |
| 70 | Ga0466705_243931 | 3300042612 | Bacteria | 5436 |
| 71 | Ga0466733_086235 | 3300042659 | Bacteria | 57120 |
| 72 | Ga0255575_1000121 | 3300026559 | Bacteria | 59640 |
| 73 | Ga0466690_198924 | 3300042590 | Bacteria | 34985 |
| 74 | Ga0466690_215880 | 3300042590 | Bacteria | 1807 |
| 75 | Ga0466692_102977 | 3300042591 | Bacteria | 2615 |
| 76 | Ga0466696_189901 | 3300042596 | Bacteria | 10950 |
| 77 | Ga0466696_197521 | 3300042596 | Bacteria | 1690 |
| 78 | Ga0466696_420828 | 3300042596 | Bacteria | 12974 |
| 79 | Ga0123354_10223030 | 3300010882 | Bacteria | 1996 |
| 80 | Ga0466711_178553 | 3300042615 | Bacteria | 5412 |
| 81 | Ga0466715_005856 | 3300042616 | Bacteria | 5612 |
| 82 | Ga0466726_235591 | 3300042619 | Bacteria | 2087 |
| 83 | Ga0466728_198023 | 3300042620 | Bacteria | 9140 |
| 84 | Ga0466706_047605 | 3300042599 | Bacteria | 73987 |
| 85 | Ga0466706_098336 | 3300042599 | Bacteria | 9784 |
| 86 | Ga0466706_256844 | 3300042599 | Bacteria | 1378 |
| 87 | Ga0466713_144823 | 3300042602 | Bacteria | 7695 |
| 88 | Ga0466714_053149 | 3300042603 | Bacteria | 4792 |
| 89 | Ga0466716_147451 | 3300042605 | Bacteria | 22878 |
| 90 | Ga0466698_099139 | 3300042610 | Bacteria | 3608 |
| 91 | Ga0466729_301768 | 3300042621 | Bacteria | 1660 |
| 92 | Ga0466735_009894 | 3300042624 | Bacteria | 1715 |
| 93 | Ga0466703_024287 | 3300042636 | Bacteria | 29560 |
| 94 | Ga0466703_043437 | 3300042636 | Bacteria | 8263 |
| 95 | Ga0466703_045817 | 3300042636 | Bacteria | 8507 |
| 96 | Ga0466703_390239 | 3300042636 | Bacteria | 3060 |
| 97 | Ga0466704_210888 | 3300042643 | Bacteria | 37471 |
| 98 | Ga0466725_259712 | 3300042654 | Bacteria | 12556 |
| 99 | Ga0466727_133513 | 3300042655 | Unclassified | 6106 |
| 100 | Ga0068305_10001223 | 3300005083 | Bacteria | 98255 |
| 101 | Ga0068305_10004897 | 3300005083 | Bacteria | 77977 |
| 102 | Ga0466705_066162 | 3300042612 | Bacteria | 7565 |
| 103 | Ga0466705_178773 | 3300042612 | Unclassified | 4424 |
| 104 | Ga0466733_050679 | 3300042659 | Bacteria | 1118 |
| 105 | Ga0466733_061998 | 3300042659 | Bacteria | 12301 |
| 106 | Ga0466733_208167 | 3300042659 | Bacteria | 31218 |
| 107 | Ga0265387_1012875 | 3300024582 | Bacteria | 1162 |
| 108 | Ga0466690_011526 | 3300042590 | Bacteria | 10291 |
| 109 | Ga0466690_033991 | 3300042590 | Bacteria | 11426 |
| 110 | Ga0466691_082783 | 3300042593 | Bacteria | 28065 |
| 111 | Ga0466696_254406 | 3300042596 | Bacteria | 1600 |
| 112 | Ga0466712_086954 | 3300042614 | Bacteria | 4381 |
| 113 | Ga0466715_056569 | 3300042616 | Bacteria | 35867 |
| 114 | Ga0466728_229448 | 3300042620 | Bacteria | 12851 |
| 115 | Ga0466728_283835 | 3300042620 | Bacteria | 1460 |
| 116 | Ga0466729_053361 | 3300042621 | Bacteria | 1782 |
| 117 | Ga0466701_037271 | 3300042598 | Bacteria | 8889 |
| 118 | Ga0466706_034191 | 3300042599 | Bacteria | 44289 |
| 119 | Ga0466706_102385 | 3300042599 | Bacteria | 3356 |
| 120 | Ga0466707_125490 | 3300042601 | Bacteria | 17968 |
| 121 | Ga0466707_306154 | 3300042601 | Bacteria | 2976 |
| 122 | Ga0466707_413602 | 3300042601 | Bacteria | 12802 |
| 123 | Ga0466713_068845 | 3300042602 | Bacteria | 14438 |
| 124 | Ga0466714_050410 | 3300042603 | Bacteria | 40060 |
| 125 | Ga0466714_053919 | 3300042603 | Bacteria | 1473 |
| 126 | Ga0466716_001967 | 3300042605 | Bacteria | 7332 |
| 127 | Ga0466716_120424 | 3300042605 | Bacteria | 2823 |
| 128 | Ga0466722_207055 | 3300042609 | Bacteria | 10529 |
| 129 | Ga0466735_064587 | 3300042624 | Bacteria | 3911 |
| 130 | Ga0466735_110848 | 3300042624 | Bacteria | 2689 |
| 131 | Ga0466735_147323 | 3300042624 | Bacteria | 1383 |
| 132 | Ga0466730_020228 | 3300042625 | Bacteria | 2512 |
| 133 | Ga0466703_126526 | 3300042636 | Bacteria | 24961 |
| 134 | Ga0466703_211551 | 3300042636 | Bacteria | 10631 |
| 135 | Ga0466704_599784 | 3300042643 | Bacteria | 1191 |
| 136 | Ga0466709_301311 | 3300042648 | Bacteria | 10280 |
| 137 | Ga0466727_347312 | 3300042655 | Bacteria | 1589 |
| 138 | Ga0466705_093655 | 3300042612 | Bacteria | 5923 |
| 139 | Ga0466690_169321 | 3300042590 | Bacteria | 11225 |
| 140 | Ga0466696_082907 | 3300042596 | Bacteria | 4944 |
| 141 | Ga0123353_10164665 | 3300010167 | Bacteria | 3526 |
| 142 | Ga0466711_000153 | 3300042615 | Bacteria | 14641 |
| 143 | Ga0466711_302388 | 3300042615 | Bacteria | 1697 |
| 144 | Ga0466715_592687 | 3300042616 | Bacteria | 16089 |
| 145 | Ga0466723_034331 | 3300042618 | Bacteria | 16866 |
| 146 | Ga0466706_043422 | 3300042599 | Bacteria | 9584 |
| 147 | Ga0466706_047496 | 3300042599 | Bacteria | 8216 |
| 148 | Ga0466706_072928 | 3300042599 | Bacteria | 51016 |
| 149 | Ga0466706_151415 | 3300042599 | Bacteria | 14671 |
| 150 | Ga0466713_064405 | 3300042602 | Bacteria | 152501 |
| 151 | Ga0466713_085321 | 3300042602 | Bacteria | 16713 |
| 152 | Ga0466713_156423 | 3300042602 | Bacteria | 30043 |
| 153 | Ga0466714_001526 | 3300042603 | Bacteria | 10345 |
| 154 | Ga0466716_080052 | 3300042605 | Unclassified | 5231 |
| 155 | Ga0466719_189344 | 3300042606 | Bacteria | 3940 |
| 156 | Ga0466735_005618 | 3300042624 | Bacteria | 2733 |
| 157 | Ga0466735_191572 | 3300042624 | Bacteria | 1073 |
| 158 | Ga0466703_189726 | 3300042636 | Bacteria | 7543 |
| 159 | Ga0466704_236841 | 3300042643 | Bacteria | 15017 |
| 160 | Ga0466704_250285 | 3300042643 | Bacteria | 39361 |
| 161 | Ga0466708_023581 | 3300042652 | Bacteria | 13912 |
| 162 | Ga0466727_047170 | 3300042655 | Bacteria | 83253 |
| 163 | Ga0466727_248193 | 3300042655 | Bacteria | 2215 |
| 164 | JGI24702J35022_10011405 | 3300002462 | Bacteria | 4952 |
| 165 | Ga0466705_080417 | 3300042612 | Bacteria | 11609 |
| 166 | Ga0466705_253431 | 3300042612 | Unclassified | 7940 |
| 167 | Ga0466733_022670 | 3300042659 | Bacteria | 13341 |
| 168 | Ga0466733_097847 | 3300042659 | Bacteria | 1332 |
| 169 | Ga0456237_0000449 | 3300041968 | Bacteria | 6230 |
| 170 | Ga0466692_048797 | 3300042591 | Bacteria | 3122 |
| 171 | Ga0466691_073130 | 3300042593 | Bacteria | 4948 |
| 172 | Ga0123353_10003728 | 3300010167 | Bacteria | 19388 |
| 173 | Ga0466715_043956 | 3300042616 | Bacteria | 8106 |
| 174 | Ga0466723_224156 | 3300042618 | Bacteria | 7701 |
| 175 | Ga0466729_193452 | 3300042621 | Bacteria | 5886 |
| 176 | Ga0466707_322791 | 3300042601 | Bacteria | 29199 |
| 177 | Ga0466713_075457 | 3300042602 | Bacteria | 24128 |
| 178 | Ga0466713_081773 | 3300042602 | Bacteria | 94516 |
| 179 | Ga0466713_129444 | 3300042602 | Bacteria | 20978 |
| 180 | Ga0466714_037174 | 3300042603 | Bacteria | 1169 |
| 181 | Ga0466714_050845 | 3300042603 | Bacteria | 2580 |
| 182 | Ga0466717_280830 | 3300042604 | Bacteria | 7600 |
| 183 | Ga0466716_405180 | 3300042605 | Bacteria | 6795 |
| 184 | Ga0466722_190419 | 3300042609 | Bacteria | 4542 |
| 185 | Ga0466735_036712 | 3300042624 | Bacteria | 2329 |
| 186 | Ga0466703_183704 | 3300042636 | Bacteria | 3343 |
| 187 | IMNBL1DRAFT_c0002869 | 3300000062 | Bacteria | 11558 |
| 188 | JGI24705J35276_12235834 | 3300002504 | Bacteria | 7035 |
| 189 | Ga0111035_100153 | 3300007901 | Bacteria | 72026 |
| 190 | Ga0466705_164418 | 3300042612 | Unclassified | 15010 |
| 191 | Ga0466705_342178 | 3300042612 | Bacteria | 42153 |
| 192 | Ga0466733_150891 | 3300042659 | Bacteria | 9991 |
| 193 | Ga0466733_189028 | 3300042659 | Bacteria | 5746 |
| 194 | Ga0466690_022508 | 3300042590 | Bacteria | 6990 |
| 195 | Ga0466696_036786 | 3300042596 | Bacteria | 23414 |
| 196 | Ga0123355_10003310 | 3300009826 | Bacteria | 23053 |
| 197 | Ga0123355_10521440 | 3300009826 | Bacteria | 1454 |
| 198 | Ga0466711_055238 | 3300042615 | Bacteria | 16327 |
| 199 | Ga0466715_038292 | 3300042616 | Bacteria | 5020 |
| 200 | Ga0466715_083165 | 3300042616 | Bacteria | 15895 |
| 201 | Ga0466726_273015 | 3300042619 | Bacteria | 1891 |
| 202 | Ga0466728_425802 | 3300042620 | Bacteria | 19622 |
| 203 | Ga0466706_017038 | 3300042599 | Bacteria | 50770 |
| 204 | Ga0466706_118499 | 3300042599 | Bacteria | 1691 |
| 205 | Ga0466706_129856 | 3300042599 | Bacteria | 1084 |
| 206 | Ga0466706_259005 | 3300042599 | Unclassified | 2210 |
| 207 | Ga0466707_214516 | 3300042601 | Bacteria | 111790 |
| 208 | Ga0466707_281968 | 3300042601 | Bacteria | 3448 |
| 209 | Ga0466707_355096 | 3300042601 | Bacteria | 3298 |
| 210 | Ga0466713_051493 | 3300042602 | Bacteria | 38137 |
| 211 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 212 | Ga0466714_057554 | 3300042603 | Bacteria | 76415 |
| 213 | Ga0466714_106812 | 3300042603 | Bacteria | 1957 |
| 214 | Ga0466716_015109 | 3300042605 | Unclassified | 3054 |
| 215 | Ga0466719_504944 | 3300042606 | Bacteria | 2660 |
| 216 | Ga0466735_203242 | 3300042624 | Bacteria | 13594 |
| 217 | Ga0466709_101021 | 3300042648 | Unclassified | 13453 |
| 218 | Ga0466727_010719 | 3300042655 | Bacteria | 5533 |
| 219 | Ga0466727_107621 | 3300042655 | Bacteria | 9293 |
| 220 | Ga0466727_312918 | 3300042655 | Bacteria | 3496 |
| 221 | 2227425252 | 2225789004 | Unclassified | 5599 |
| 222 | Ga0072941_1214418 | 3300005201 | Bacteria | 7131 |
| 223 | Ga0466733_095282 | 3300042659 | Bacteria | 5457 |
| 224 | Ga0466733_182643 | 3300042659 | Unclassified | 5662 |
| 225 | Ga0466733_200633 | 3300042659 | Bacteria | 7367 |
| 226 | Ga0562375_0091 | 3300056856 | Bacteria | 283318 |
| 227 | Ga0466690_023436 | 3300042590 | Bacteria | 9478 |
| 228 | Ga0466691_183265 | 3300042593 | Bacteria | 11148 |
| 229 | Ga0466694_202319 | 3300042594 | Bacteria | 4666 |
| 230 | Ga0466696_178696 | 3300042596 | Bacteria | 8383 |
| 231 | Ga0466696_208836 | 3300042596 | Bacteria | 44609 |
| 232 | Ga0123355_10000182 | 3300009826 | Bacteria | 77682 |
| 233 | Ga0466711_135365 | 3300042615 | Bacteria | 14177 |
| 234 | Ga0466711_225552 | 3300042615 | Bacteria | 18887 |
| 235 | Ga0466711_326802 | 3300042615 | Bacteria | 7274 |
| 236 | Ga0466711_343215 | 3300042615 | Bacteria | 7862 |
| 237 | Ga0466715_018494 | 3300042616 | Bacteria | 8984 |
| 238 | Ga0466715_607828 | 3300042616 | Bacteria | 77672 |
| 239 | Ga0466707_144426 | 3300042601 | Bacteria | 7010 |
| 240 | Ga0466707_262352 | 3300042601 | Bacteria | 9976 |
| 241 | Ga0466719_079794 | 3300042606 | Bacteria | 11280 |
| 242 | Ga0466719_342207 | 3300042606 | Bacteria | 10888 |
| 243 | Ga0466722_262403 | 3300042609 | Bacteria | 1760 |
| 244 | Ga0466703_071422 | 3300042636 | Bacteria | 20891 |
| 245 | Ga0466703_175205 | 3300042636 | Bacteria | 25111 |
| 246 | Ga0466704_045996 | 3300042643 | Bacteria | 2444 |
| 247 | Ga0466704_147742 | 3300042643 | Bacteria | 15020 |
| 248 | Ga0466709_169723 | 3300042648 | Bacteria | 216757 |
| 249 | Ga0466727_100129 | 3300042655 | Bacteria | 2353 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.