Protein Family IF05814
Metagenome
Isolate
188
Members
60
Samples
174
Scaffolds
149.51
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_081294|Ga0466707_081294_536_1066
- Length
- 176 aa
- Sequence
- VRFFIEKIVPLQNPMKKIYLMENETTNQERIGLASDHAGYELKEFVRILLDKKGIPYIDYGTYSTESVNYAEYGHKLATAIETDEVCKGIAVCGSGNGINMTLNKHAAIRSALCWDEEITTLARQHNNANVLALPGRFLSLDLAEKMVDAFLNTPFEGGRHQTRIDMIPVQSSTIN
Sample Types
Isolate
7.5%
Metagenome
92.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.6%
Kalotermitidae
24.1%
Unclassified
17.2%
Blattidae
10.3%
Rhinotermitidae
8.6%
Termopsidae
6.9%
Passalidae
3.4%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
183
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 16 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 19 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 20 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 39 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 40 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 45 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 46 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 48 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 51 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 52 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 53 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 54 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 55 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 56 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 57 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 58 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 59 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 60 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_300684 | 3300042590 | Bacteria | 9247 |
| 2 | Ga0466723_214552 | 3300042618 | Bacteria | 46791 |
| 3 | Ga0466729_189225 | 3300042621 | Bacteria | 4162 |
| 4 | JGI24699J35502_11134116 | 3300002509 | Bacteria | 32708 |
| 5 | Ga0123357_10087136 | 3300009784 | Unclassified | 4084 |
| 6 | Ga0123356_10056907 | 3300010049 | Bacteria | 3644 |
| 7 | Ga0123354_10026728 | 3300010882 | Bacteria | 9102 |
| 8 | Ga0466735_076560 | 3300042624 | Bacteria | 1719 |
| 9 | Ga0466704_235481 | 3300042643 | Unclassified | 3881 |
| 10 | Ga0466708_401848 | 3300042652 | Bacteria | 33683 |
| 11 | Ga0466706_169288 | 3300042599 | Bacteria | 28222 |
| 12 | Ga0466700_263454 | 3300042600 | Bacteria | 1320 |
| 13 | Ga0466713_094496 | 3300042602 | Bacteria | 333875 |
| 14 | Ga0466714_153533 | 3300042603 | Bacteria | 6524 |
| 15 | Ga0466716_187453 | 3300042605 | Bacteria | 14311 |
| 16 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 17 | Ga0466690_008159 | 3300042590 | Bacteria | 4273 |
| 18 | Ga0466690_151487 | 3300042590 | Bacteria | 12165 |
| 19 | Ga0466690_276223 | 3300042590 | Bacteria | 213056 |
| 20 | Ga0466691_050459 | 3300042593 | Bacteria | 6876 |
| 21 | Ga0466696_097705 | 3300042596 | Bacteria | 18993 |
| 22 | Ga0466705_084098 | 3300042612 | Bacteria | 5230 |
| 23 | Ga0466711_227310 | 3300042615 | Bacteria | 1307 |
| 24 | Ga0466715_309862 | 3300042616 | Bacteria | 99913 |
| 25 | Ga0466723_162153 | 3300042618 | Bacteria | 20380 |
| 26 | JGI24705J35276_12234460 | 3300002504 | Bacteria | 5544 |
| 27 | JGI24699J35502_11134110 | 3300002509 | Bacteria | 31696 |
| 28 | JGI24696J40584_12781311 | 3300002834 | Bacteria | 837 |
| 29 | Ga0068305_10002901 | 3300005083 | Bacteria | 3192 |
| 30 | Ga0123357_10088723 | 3300009784 | Bacteria | 4039 |
| 31 | Ga0123357_10213395 | 3300009784 | Bacteria | 2162 |
| 32 | Ga0123356_10661269 | 3300010049 | Bacteria | 1212 |
| 33 | Ga0123354_10349861 | 3300010882 | Bacteria | 1319 |
| 34 | Ga0466735_094761 | 3300042624 | Bacteria | 5403 |
| 35 | Ga0466735_098112 | 3300042624 | Bacteria | 9495 |
| 36 | Ga0466703_030263 | 3300042636 | Bacteria | 2601 |
| 37 | Ga0466703_110346 | 3300042636 | Bacteria | 10941 |
| 38 | Ga0466703_232448 | 3300042636 | Bacteria | 16803 |
| 39 | Ga0466703_275769 | 3300042636 | Bacteria | 24178 |
| 40 | Ga0466704_057862 | 3300042643 | Bacteria | 4422 |
| 41 | Ga0466713_047571 | 3300042602 | Bacteria | 55256 |
| 42 | Ga0466713_098035 | 3300042602 | Bacteria | 1365 |
| 43 | Ga0466719_275937 | 3300042606 | Bacteria | 4992 |
| 44 | Ga0466690_026344 | 3300042590 | Bacteria | 8824 |
| 45 | Ga0466691_070467 | 3300042593 | Bacteria | 27137 |
| 46 | Ga0466715_313220 | 3300042616 | Bacteria | 2467 |
| 47 | Ga0466715_577426 | 3300042616 | Bacteria | 23723 |
| 48 | Ga0466723_019514 | 3300042618 | Bacteria | 18988 |
| 49 | Ga0466723_125065 | 3300042618 | Bacteria | 5490 |
| 50 | 2227625195 | 2225789004 | Unclassified | 2161 |
| 51 | IMNBL1DRAFT_c0052894 | 3300000062 | Bacteria | 1269 |
| 52 | JGI24702J35022_10228722 | 3300002462 | Bacteria | 1075 |
| 53 | JGI24702J35022_10641450 | 3300002462 | Bacteria | 658 |
| 54 | JGI24696J40584_12956209 | 3300002834 | Bacteria | 3042 |
| 55 | Ga0123357_10080101 | 3300009784 | Bacteria | 4297 |
| 56 | Ga0123357_10190802 | 3300009784 | Bacteria | 2362 |
| 57 | Ga0123356_10609838 | 3300010049 | Bacteria | 1256 |
| 58 | Ga0123354_10270559 | 3300010882 | Bacteria | 1673 |
| 59 | Ga0466735_066678 | 3300042624 | Bacteria | 1436 |
| 60 | Ga0466735_207707 | 3300042624 | Bacteria | 3125 |
| 61 | Ga0466703_042304 | 3300042636 | Bacteria | 3162 |
| 62 | Ga0466704_485980 | 3300042643 | Bacteria | 3657 |
| 63 | Ga0466709_317524 | 3300042648 | Bacteria | 24158 |
| 64 | Ga0466727_156594 | 3300042655 | Bacteria | 16414 |
| 65 | Ga0466733_178820 | 3300042659 | Bacteria | 3157 |
| 66 | Ga0466701_015885 | 3300042598 | Bacteria | 21780 |
| 67 | Ga0466707_081294 | 3300042601 | Bacteria | 2664 |
| 68 | Ga0466719_192587 | 3300042606 | Bacteria | 4512 |
| 69 | Ga0466690_340718 | 3300042590 | Bacteria | 6390 |
| 70 | Ga0466692_112723 | 3300042591 | Bacteria | 1252 |
| 71 | Ga0466692_131543 | 3300042591 | Bacteria | 18183 |
| 72 | Ga0466694_321259 | 3300042594 | Bacteria | 1928 |
| 73 | Ga0466696_024018 | 3300042596 | Bacteria | 4351 |
| 74 | IMNBL1DRAFT_c0030942 | 3300000062 | Bacteria | 1954 |
| 75 | JGI24699J35502_11134146 | 3300002509 | Bacteria | 37464 |
| 76 | Ga0123354_10000304 | 3300010882 | Bacteria | 45275 |
| 77 | Ga0466735_054398 | 3300042624 | Bacteria | 1836 |
| 78 | Ga0466703_354222 | 3300042636 | Bacteria | 2475 |
| 79 | Ga0466704_364403 | 3300042643 | Bacteria | 8740 |
| 80 | Ga0466700_061727 | 3300042600 | Bacteria | 1813 |
| 81 | Ga0466700_253470 | 3300042600 | Bacteria | 10880 |
| 82 | Ga0466707_028892 | 3300042601 | Bacteria | 14574 |
| 83 | Ga0466707_164844 | 3300042601 | Bacteria | 38674 |
| 84 | Ga0466707_228637 | 3300042601 | Bacteria | 18129 |
| 85 | Ga0466707_296748 | 3300042601 | Bacteria | 1634 |
| 86 | Ga0466719_035507 | 3300042606 | Bacteria | 3467 |
| 87 | Ga0466719_092837 | 3300042606 | Bacteria | 5518 |
| 88 | Ga0466719_128512 | 3300042606 | Bacteria | 7271 |
| 89 | Ga0456237_0000028 | 3300041968 | Bacteria | 21979 |
| 90 | Ga0466692_176840 | 3300042591 | Bacteria | 3782 |
| 91 | Ga0466696_088815 | 3300042596 | Bacteria | 5607 |
| 92 | Ga0466696_390997 | 3300042596 | Bacteria | 11169 |
| 93 | Ga0466711_276576 | 3300042615 | Bacteria | 40894 |
| 94 | Ga0466726_052749 | 3300042619 | Bacteria | 15242 |
| 95 | Ga0466728_077594 | 3300042620 | Bacteria | 12127 |
| 96 | IMNBL1DRAFT_c0003093 | 3300000062 | Bacteria | 10976 |
| 97 | IMNBL1DRAFT_c0004037 | 3300000062 | Unclassified | 9018 |
| 98 | IMNBL1DRAFT_c0008162 | 3300000062 | Bacteria | 5377 |
| 99 | JGI24702J35022_10084052 | 3300002462 | Bacteria | 1727 |
| 100 | JGI24699J35502_11133759 | 3300002509 | Bacteria | 14944 |
| 101 | Ga0068305_10354433 | 3300005083 | Bacteria | 972 |
| 102 | Ga0123357_10002953 | 3300009784 | Bacteria | 19216 |
| 103 | Ga0123357_10475729 | 3300009784 | Bacteria | 1060 |
| 104 | Ga0123354_10005938 | 3300010882 | Bacteria | 17964 |
| 105 | Ga0123354_10037503 | 3300010882 | Bacteria | 7544 |
| 106 | Ga0123354_10196051 | 3300010882 | Bacteria | 2240 |
| 107 | Ga0123354_10200564 | 3300010882 | Bacteria | 2195 |
| 108 | Ga0466735_107301 | 3300042624 | Bacteria | 4068 |
| 109 | Ga0466735_227342 | 3300042624 | Bacteria | 16781 |
| 110 | Ga0466704_379904 | 3300042643 | Bacteria | 21264 |
| 111 | Ga0466709_125562 | 3300042648 | Bacteria | 2524 |
| 112 | Ga0466727_082967 | 3300042655 | Bacteria | 3607 |
| 113 | Ga0466713_061377 | 3300042602 | Bacteria | 3194 |
| 114 | Ga0466713_080452 | 3300042602 | Bacteria | 6401 |
| 115 | Ga0466716_192171 | 3300042605 | Unclassified | 5293 |
| 116 | Ga0466705_195293 | 3300042612 | Bacteria | 9820 |
| 117 | Ga0466712_128976 | 3300042614 | Bacteria | 1425 |
| 118 | Ga0466715_015063 | 3300042616 | Bacteria | 14765 |
| 119 | Ga0466715_072985 | 3300042616 | Bacteria | 14761 |
| 120 | IMNBL1DRAFT_c0004404 | 3300000062 | Bacteria | 8488 |
| 121 | JGI24702J35022_10002685 | 3300002462 | Bacteria | 10803 |
| 122 | JGI24696J40584_12944584 | 3300002834 | Bacteria | 1818 |
| 123 | Ga0105524_107082 | 3300007733 | Bacteria | 1692 |
| 124 | Ga0123357_10122116 | 3300009784 | Bacteria | 3278 |
| 125 | Ga0123356_10031295 | 3300010049 | Bacteria | 4980 |
| 126 | Ga0123353_10129925 | 3300010167 | Bacteria | 4044 |
| 127 | Ga0466735_098439 | 3300042624 | Bacteria | 1780 |
| 128 | Ga0466727_337756 | 3300042655 | Bacteria | 3368 |
| 129 | Ga0466733_075564 | 3300042659 | Bacteria | 3542 |
| 130 | Ga0466706_232222 | 3300042599 | Bacteria | 1897 |
| 131 | Ga0466707_386843 | 3300042601 | Bacteria | 4903 |
| 132 | Ga0466713_075045 | 3300042602 | Bacteria | 13360 |
| 133 | Ga0466722_002451 | 3300042609 | Bacteria | 3773 |
| 134 | Ga0466722_178696 | 3300042609 | Bacteria | 8053 |
| 135 | Ga0466692_179212 | 3300042591 | Bacteria | 27849 |
| 136 | Ga0466692_190832 | 3300042591 | Bacteria | 7445 |
| 137 | Ga0466705_406481 | 3300042612 | Bacteria | 3519 |
| 138 | 2227480228 | 2225789004 | Bacteria | 4458 |
| 139 | JGI24705J35276_12199851 | 3300002504 | Bacteria | 1592 |
| 140 | Ga0123356_10013227 | 3300010049 | Bacteria | 7981 |
| 141 | Ga0123356_10663163 | 3300010049 | Bacteria | 1211 |
| 142 | Ga0123353_10254231 | 3300010167 | Bacteria | 2719 |
| 143 | Ga0123354_10016643 | 3300010882 | Bacteria | 11521 |
| 144 | Ga0123354_10101927 | 3300010882 | Bacteria | 3873 |
| 145 | Ga0466704_155616 | 3300042643 | Bacteria | 11209 |
| 146 | Ga0466727_024077 | 3300042655 | Bacteria | 10938 |
| 147 | Ga0466727_338836 | 3300042655 | Bacteria | 3941 |
| 148 | Ga0466700_365612 | 3300042600 | Bacteria | 6498 |
| 149 | Ga0466707_373803 | 3300042601 | Bacteria | 20483 |
| 150 | Ga0466713_045750 | 3300042602 | Bacteria | 35229 |
| 151 | Ga0466713_144564 | 3300042602 | Bacteria | 44905 |
| 152 | Ga0466722_016629 | 3300042609 | Bacteria | 5853 |
| 153 | Ga0265387_1005799 | 3300024582 | Bacteria | 1665 |
| 154 | Ga0466692_060366 | 3300042591 | Bacteria | 2577 |
| 155 | Ga0466692_167512 | 3300042591 | Bacteria | 9598 |
| 156 | Ga0466701_001128 | 3300042598 | Bacteria | 4040 |
| 157 | Ga0466705_351659 | 3300042612 | Bacteria | 6669 |
| 158 | Ga0466711_172335 | 3300042615 | Bacteria | 8197 |
| 159 | Ga0466723_245376 | 3300042618 | Bacteria | 10412 |
| 160 | Ga0466726_106548 | 3300042619 | Bacteria | 18359 |
| 161 | IMNBL1DRAFT_c0011350 | 3300000062 | Bacteria | 4169 |
| 162 | Ga0068302_10050637 | 3300005071 | Bacteria | 6420 |
| 163 | Ga0068305_10816378 | 3300005083 | Bacteria | 2244 |
| 164 | Ga0123357_10000970 | 3300009784 | Bacteria | 29214 |
| 165 | Ga0123355_10131799 | 3300009826 | Bacteria | 3850 |
| 166 | Ga0123353_10630518 | 3300010167 | Bacteria | 1523 |
| 167 | Ga0123353_10714408 | 3300010167 | Bacteria | 1403 |
| 168 | Ga0123354_10137986 | 3300010882 | Bacteria | 3036 |
| 169 | Ga0123354_10302270 | 3300010882 | Bacteria | 1511 |
| 170 | Ga0466734_057558 | 3300042623 | Bacteria | 1216 |
| 171 | Ga0466735_030281 | 3300042624 | Bacteria | 4076 |
| 172 | Ga0466703_002530 | 3300042636 | Bacteria | 34046 |
| 173 | Ga0466704_056912 | 3300042643 | Bacteria | 6299 |
| 174 | Ga0466704_458285 | 3300042643 | Bacteria | 3893 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02502 | LacAB_rpiB | Ribose/Galactose Isomerase | 31 | 168 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.