Protein Family IF05690
Metagenome
Isolate
301
Members
99
Samples
267
Scaffolds
473.17
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_253517|Ga0466706_253517_158_1813
- Length
- 551 aa
- Sequence
- MSAVIVLCRQPTSQTALPCLSSAAVRDLSVGCHIVSSCSQRYRFCEYGILLFPKSALYWQRTIKSKQLLNNTYICRQIDFTMTNNKMTNYRWVICAMLFFATTVNYLDRQVLSLLQPLLEEQFHWTDTDYGNITGVFSLFYAVCMLFAGRFVDKVGTKRGYAWAIAIWSVGAAVHAVCGTITKSWLGIADDAALRAVVGGTDLAAQISLISVTAFIVCRCVLALGEAGNFPAAIKATAEYFPKKDRAFATGIFNSGANVGAIIAPLSVPFMAEYWGWEAAFIITGMIGFVWLGIWLFVYKRPEDNASMNEAERAYILQDDTDNIQEGTDTDRKIPFLKCLTYRQTWAFAFGKFMTDGVWWFFLFWTPAYLKAQYGMEGTAIAMPIAVLYSITVIGSVFGGKFPTYFINKGMNPYSGRMLAMLIIAFFPLFVLLAQPLGYMSFWAPILLIAVGASAHQAWSANIFSTVGDMFPKGAIATVTGIGGMAGGVGSFFIQRAAGQLFTFSDETQMVFMGFEGKSAGYAIAFIFCALAYIIAWCVMKALVPKYKLIR
Sample Types
Isolate
11.3%
Metagenome
88.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
17.8%
Kalotermitidae
15.6%
Unclassified
12.2%
Culicidae
8.9%
Blattidae
7.8%
Elmidae
6.7%
Rhinotermitidae
5.6%
Curculionidae
5.6%
Formicidae
4.4%
Termopsidae
4.4%
Drosophilidae
3.3%
Passalidae
3.3%
Armadillidiidae
3.3%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
284
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 2 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 3 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 4 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 5 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 6 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 21 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 22 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 23 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 24 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 25 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 30 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 31 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 32 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 35 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 36 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 37 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 38 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 39 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 40 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 41 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 44 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 45 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 46 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 47 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 48 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 49 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 50 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 51 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 52 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 53 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 54 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 55 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 56 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 57 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 58 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 59 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 60 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 61 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 62 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 63 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 64 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 65 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 66 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 67 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 68 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 69 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 70 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 71 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 72 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 73 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 74 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 75 | 2687453757 | Opitutus sp. Cag34 | Isolate | Unclassified |
| 76 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 77 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 78 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 79 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 80 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 81 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 82 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 83 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 84 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 85 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 86 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 87 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 88 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 89 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 90 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 91 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 92 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 93 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 94 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 95 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 96 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 97 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 98 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 99 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_039692 | 3300042616 | Bacteria | 7405 |
| 2 | Ga0466715_042591 | 3300042616 | Bacteria | 14628 |
| 3 | Ga0466715_359104 | 3300042616 | Unclassified | 9677 |
| 4 | Ga0466728_241273 | 3300042620 | Bacteria | 5533 |
| 5 | Ga0466707_383706 | 3300042601 | Bacteria | 14948 |
| 6 | Ga0466713_129444 | 3300042602 | Bacteria | 20978 |
| 7 | Ga0466719_023154 | 3300042606 | Bacteria | 2143 |
| 8 | Ga0466720_166223 | 3300042607 | Bacteria | 17877 |
| 9 | Ga0466722_182041 | 3300042609 | Bacteria | 8258 |
| 10 | Ga0466735_010498 | 3300042624 | Bacteria | 8453 |
| 11 | Ga0466735_150640 | 3300042624 | Bacteria | 8279 |
| 12 | Ga0466704_127714 | 3300042643 | Bacteria | 16130 |
| 13 | Ga0466704_491621 | 3300042643 | Bacteria | 7003 |
| 14 | Ga0466709_090235 | 3300042648 | Unclassified | 1695 |
| 15 | Ga0466708_082955 | 3300042652 | Bacteria | 55601 |
| 16 | Ga0466727_031232 | 3300042655 | Bacteria | 8118 |
| 17 | Ga0466727_072326 | 3300042655 | Bacteria | 142607 |
| 18 | Ga0466727_134489 | 3300042655 | Unclassified | 2231 |
| 19 | Ga0466727_213308 | 3300042655 | Bacteria | 3205 |
| 20 | Ga0466727_219070 | 3300042655 | Bacteria | 17923 |
| 21 | Ga0466727_245440 | 3300042655 | Bacteria | 2446 |
| 22 | Ga0466690_148646 | 3300042590 | Bacteria | 30636 |
| 23 | Ga0466690_296510 | 3300042590 | Bacteria | 22089 |
| 24 | Ga0466692_140165 | 3300042591 | Bacteria | 13758 |
| 25 | Ga0466691_074846 | 3300042593 | Bacteria | 24110 |
| 26 | Ga0466696_074134 | 3300042596 | Bacteria | 6091 |
| 27 | Ga0466696_291594 | 3300042596 | Bacteria | 1782 |
| 28 | DPOL_contig05279 | 2035918003 | Unclassified | 7478 |
| 29 | JGI24702J35022_10002310 | 3300002462 | Bacteria | 11681 |
| 30 | Ga0068302_10000145 | 3300005071 | Unclassified | 4752 |
| 31 | Ga0068305_10032849 | 3300005083 | Bacteria | 59151 |
| 32 | Ga0102734_1006570 | 3300007129 | Bacteria | 2610 |
| 33 | Ga0102740_1000320 | 3300007140 | Bacteria | 13557 |
| 34 | Ga0123357_10003504 | 3300009784 | Bacteria | 18046 |
| 35 | Ga0466733_076287 | 3300042659 | Bacteria | 1991 |
| 36 | Ga0466733_129283 | 3300042659 | Bacteria | 27337 |
| 37 | Ga0466715_359435 | 3300042616 | Unclassified | 30521 |
| 38 | Ga0466718_055614 | 3300042617 | Bacteria | 9929 |
| 39 | Ga0466726_302243 | 3300042619 | Bacteria | 5090 |
| 40 | Ga0466728_378724 | 3300042620 | Bacteria | 10575 |
| 41 | Ga0466706_253517 | 3300042599 | Bacteria | 2140 |
| 42 | Ga0466713_025355 | 3300042602 | Bacteria | 7532 |
| 43 | Ga0466713_046953 | 3300042602 | Bacteria | 18693 |
| 44 | Ga0466714_090524 | 3300042603 | Bacteria | 10660 |
| 45 | Ga0466722_074435 | 3300042609 | Bacteria | 37165 |
| 46 | Ga0466703_106402 | 3300042636 | Bacteria | 8550 |
| 47 | Ga0466703_238426 | 3300042636 | Bacteria | 1780 |
| 48 | Ga0466704_120294 | 3300042643 | Bacteria | 16016 |
| 49 | Ga0466709_390589 | 3300042648 | Bacteria | 49108 |
| 50 | Ga0466708_016960 | 3300042652 | Bacteria | 21170 |
| 51 | Ga0466708_246063 | 3300042652 | Bacteria | 25365 |
| 52 | Ga0123354_10000424 | 3300010882 | Bacteria | 41153 |
| 53 | Ga0123354_10044196 | 3300010882 | Bacteria | 6835 |
| 54 | Ga0160452_101371 | 3300012834 | Bacteria | 7134 |
| 55 | Ga0160448_100377 | 3300012854 | Bacteria | 15833 |
| 56 | Ga0160448_106221 | 3300012854 | Bacteria | 3013 |
| 57 | Ga0466690_010564 | 3300042590 | Bacteria | 4989 |
| 58 | Ga0466690_026963 | 3300042590 | Unclassified | 4323 |
| 59 | Ga0466690_143907 | 3300042590 | Bacteria | 12582 |
| 60 | JGI24699J35502_11134195 | 3300002509 | Bacteria | 51638 |
| 61 | Ga0068305_10001607 | 3300005083 | Bacteria | 146538 |
| 62 | Ga0072941_1003943 | 3300005201 | Bacteria | 7832 |
| 63 | Ga0466733_138785 | 3300042659 | Bacteria | 4570 |
| 64 | Ga0466711_163307 | 3300042615 | Bacteria | 57894 |
| 65 | Ga0466715_029087 | 3300042616 | Bacteria | 29670 |
| 66 | Ga0466715_513414 | 3300042616 | Bacteria | 2322 |
| 67 | Ga0466715_592687 | 3300042616 | Bacteria | 16089 |
| 68 | Ga0466723_114888 | 3300042618 | Bacteria | 8393 |
| 69 | Ga0466726_387678 | 3300042619 | Bacteria | 397429 |
| 70 | Ga0466728_326796 | 3300042620 | Bacteria | 10674 |
| 71 | Ga0466713_064405 | 3300042602 | Bacteria | 152501 |
| 72 | Ga0466713_085321 | 3300042602 | Bacteria | 16713 |
| 73 | Ga0466714_043359 | 3300042603 | Bacteria | 3155 |
| 74 | Ga0466716_071597 | 3300042605 | Bacteria | 1697 |
| 75 | Ga0466719_130653 | 3300042606 | Bacteria | 158630 |
| 76 | Ga0466719_189344 | 3300042606 | Bacteria | 3940 |
| 77 | Ga0466735_150074 | 3300042624 | Bacteria | 28864 |
| 78 | Ga0466735_181000 | 3300042624 | Bacteria | 1958 |
| 79 | Ga0466703_398344 | 3300042636 | Bacteria | 2341 |
| 80 | Ga0466703_415672 | 3300042636 | Bacteria | 2230 |
| 81 | Ga0466704_038135 | 3300042643 | Bacteria | 5390 |
| 82 | Ga0466704_250285 | 3300042643 | Bacteria | 39361 |
| 83 | Ga0466704_434433 | 3300042643 | Bacteria | 7839 |
| 84 | Ga0466708_023581 | 3300042652 | Bacteria | 13912 |
| 85 | Ga0466727_047170 | 3300042655 | Bacteria | 83253 |
| 86 | Ga0466727_054745 | 3300042655 | Bacteria | 10260 |
| 87 | Ga0123356_10017920 | 3300010049 | Bacteria | 6727 |
| 88 | Ga0160456_100968 | 3300012820 | Bacteria | 7556 |
| 89 | Ga0160457_1000001 | 3300012858 | Bacteria | 1192173 |
| 90 | Ga0466696_062766 | 3300042596 | Bacteria | 9636 |
| 91 | Ga0466696_208380 | 3300042596 | Bacteria | 4518 |
| 92 | IMNBL1DRAFT_c0000444 | 3300000062 | Bacteria | 34756 |
| 93 | CVPL010W_10002679 | 3300002931 | Bacteria | 20773 |
| 94 | Ga0104019_1000225 | 3300007150 | Bacteria | 30614 |
| 95 | Ga0466705_102627 | 3300042612 | Bacteria | 8197 |
| 96 | Ga0466705_322414 | 3300042612 | Bacteria | 5957 |
| 97 | Ga0466705_494406 | 3300042612 | Bacteria | 9318 |
| 98 | Ga0466715_243098 | 3300042616 | Bacteria | 16004 |
| 99 | Ga0466715_325075 | 3300042616 | Bacteria | 6577 |
| 100 | Ga0466723_059740 | 3300042618 | Bacteria | 18572 |
| 101 | Ga0466723_093820 | 3300042618 | Bacteria | 7056 |
| 102 | Ga0466726_135382 | 3300042619 | Bacteria | 13356 |
| 103 | Ga0466726_172860 | 3300042619 | Bacteria | 2266 |
| 104 | Ga0466726_277754 | 3300042619 | Bacteria | 2219 |
| 105 | Ga0466726_312878 | 3300042619 | Bacteria | 9768 |
| 106 | Ga0466726_393773 | 3300042619 | Bacteria | 11137 |
| 107 | Ga0466713_082426 | 3300042602 | Bacteria | 104514 |
| 108 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 109 | Ga0466714_027167 | 3300042603 | Bacteria | 3562 |
| 110 | Ga0466714_157561 | 3300042603 | Bacteria | 10125 |
| 111 | Ga0466719_040767 | 3300042606 | Bacteria | 242892 |
| 112 | Ga0466722_015103 | 3300042609 | Bacteria | 27580 |
| 113 | Ga0466735_030308 | 3300042624 | Bacteria | 3270 |
| 114 | Ga0466735_039152 | 3300042624 | Bacteria | 4770 |
| 115 | Ga0466735_193546 | 3300042624 | Bacteria | 6227 |
| 116 | Ga0466735_195127 | 3300042624 | Bacteria | 2569 |
| 117 | Ga0466703_148567 | 3300042636 | Bacteria | 10604 |
| 118 | Ga0466708_088526 | 3300042652 | Bacteria | 25315 |
| 119 | Ga0123357_10307883 | 3300009784 | Bacteria | 1587 |
| 120 | Ga0123354_10039410 | 3300010882 | Bacteria | 7323 |
| 121 | Ga0123354_10052799 | 3300010882 | Bacteria | 6120 |
| 122 | Ga0123354_10131402 | 3300010882 | Unclassified | 3161 |
| 123 | Ga0160470_100669 | 3300012813 | Bacteria | 11345 |
| 124 | Ga0466690_227258 | 3300042590 | Bacteria | 10959 |
| 125 | Ga0466691_146559 | 3300042593 | Bacteria | 21127 |
| 126 | DPO_contig08437 | 2032320009 | Bacteria | 9948 |
| 127 | SPBB_contig00360 | 2044078006 | Bacteria | 40893 |
| 128 | Ga0068305_10064566 | 3300005083 | Bacteria | 11214 |
| 129 | Ga0466705_093532 | 3300042612 | Bacteria | 3890 |
| 130 | Ga0466733_122498 | 3300042659 | Bacteria | 43456 |
| 131 | Ga0466710_217061 | 3300042613 | Bacteria | 1807 |
| 132 | Ga0466711_086874 | 3300042615 | Bacteria | 2601 |
| 133 | Ga0466711_117944 | 3300042615 | Bacteria | 215972 |
| 134 | Ga0466728_065173 | 3300042620 | Unclassified | 2988 |
| 135 | Ga0466728_258460 | 3300042620 | Bacteria | 5288 |
| 136 | Ga0466700_102718 | 3300042600 | Bacteria | 2658 |
| 137 | Ga0466713_020921 | 3300042602 | Bacteria | 109196 |
| 138 | Ga0466713_037152 | 3300042602 | Bacteria | 95451 |
| 139 | Ga0466714_162566 | 3300042603 | Bacteria | 1703 |
| 140 | Ga0466735_020437 | 3300042624 | Bacteria | 8981 |
| 141 | Ga0466735_030430 | 3300042624 | Bacteria | 5569 |
| 142 | Ga0466703_187656 | 3300042636 | Bacteria | 10684 |
| 143 | Ga0466724_57176 | 3300042649 | Bacteria | 35773 |
| 144 | Ga0466708_056254 | 3300042652 | Bacteria | 11846 |
| 145 | Ga0466727_320410 | 3300042655 | Unclassified | 3784 |
| 146 | Ga0123355_10222647 | 3300009826 | Bacteria | 2710 |
| 147 | Ga0123356_10014727 | 3300010049 | Bacteria | 7513 |
| 148 | Ga0123356_10040032 | 3300010049 | Bacteria | 4367 |
| 149 | Ga0123356_10085286 | 3300010049 | Bacteria | 2995 |
| 150 | Ga0123354_10000013 | 3300010882 | Bacteria | 155838 |
| 151 | Ga0160445_100002 | 3300012847 | Bacteria | 638897 |
| 152 | Ga0466690_152343 | 3300042590 | Bacteria | 6606 |
| 153 | Ga0466690_291594 | 3300042590 | Bacteria | 3970 |
| 154 | Ga0466692_073756 | 3300042591 | Bacteria | 1707 |
| 155 | Ga0466691_035208 | 3300042593 | Bacteria | 19307 |
| 156 | Ga0466691_214494 | 3300042593 | Bacteria | 20188 |
| 157 | Ga0466696_311442 | 3300042596 | Bacteria | 4517 |
| 158 | Ga0466705_326516 | 3300042612 | Bacteria | 6288 |
| 159 | Ga0466733_177532 | 3300042659 | Bacteria | 1996 |
| 160 | Ga0466711_135365 | 3300042615 | Bacteria | 14177 |
| 161 | Ga0466711_139172 | 3300042615 | Bacteria | 19591 |
| 162 | Ga0466711_270621 | 3300042615 | Bacteria | 2179 |
| 163 | Ga0466711_427065 | 3300042615 | Bacteria | 8167 |
| 164 | Ga0466726_396983 | 3300042619 | Bacteria | 7725 |
| 165 | Ga0466728_106900 | 3300042620 | Bacteria | 12160 |
| 166 | Ga0466707_081839 | 3300042601 | Bacteria | 22933 |
| 167 | Ga0466707_103559 | 3300042601 | Bacteria | 2038 |
| 168 | Ga0466707_144426 | 3300042601 | Bacteria | 7010 |
| 169 | Ga0466713_148609 | 3300042602 | Bacteria | 76381 |
| 170 | Ga0466714_164818 | 3300042603 | Bacteria | 1744 |
| 171 | Ga0466716_070871 | 3300042605 | Bacteria | 3120 |
| 172 | Ga0466719_006711 | 3300042606 | Bacteria | 13342 |
| 173 | Ga0466719_342207 | 3300042606 | Bacteria | 10888 |
| 174 | Ga0466735_006539 | 3300042624 | Bacteria | 4006 |
| 175 | Ga0466735_056143 | 3300042624 | Bacteria | 16646 |
| 176 | Ga0466703_110964 | 3300042636 | Bacteria | 165564 |
| 177 | Ga0466703_175205 | 3300042636 | Bacteria | 25111 |
| 178 | Ga0466704_376819 | 3300042643 | Bacteria | 49548 |
| 179 | Ga0466709_169723 | 3300042648 | Bacteria | 216757 |
| 180 | Ga0466708_183699 | 3300042652 | Unclassified | 20419 |
| 181 | Ga0123356_10000126 | 3300010049 | Bacteria | 84443 |
| 182 | Ga0123356_10005895 | 3300010049 | Bacteria | 12439 |
| 183 | Ga0123356_10026071 | 3300010049 | Bacteria | 5495 |
| 184 | Ga0123354_10079237 | 3300010882 | Bacteria | 4662 |
| 185 | Ga0160453_100011 | 3300012814 | Bacteria | 295926 |
| 186 | Ga0466690_027762 | 3300042590 | Unclassified | 12179 |
| 187 | Ga0466690_159465 | 3300042590 | Bacteria | 4733 |
| 188 | Ga0466690_362245 | 3300042590 | Unclassified | 1935 |
| 189 | Ga0466692_078137 | 3300042591 | Bacteria | 56214 |
| 190 | Ga0466691_081942 | 3300042593 | Bacteria | 15397 |
| 191 | Ga0466696_029290 | 3300042596 | Bacteria | 39093 |
| 192 | Ga0466696_178696 | 3300042596 | Bacteria | 8383 |
| 193 | Ga0466699_242223 | 3300042597 | Bacteria | 8789 |
| 194 | IMNBL1DRAFT_c0003643 | 3300000062 | Bacteria | 9727 |
| 195 | Ga0068302_10188892 | 3300005071 | Bacteria | 1917 |
| 196 | Ga0072940_1014112 | 3300005200 | Bacteria | 37243 |
| 197 | Ga0104041_1110852 | 3300007106 | Bacteria | 2336 |
| 198 | Ga0466733_132175 | 3300042659 | Bacteria | 14035 |
| 199 | Ga0466733_189028 | 3300042659 | Bacteria | 5746 |
| 200 | Ga0466711_086801 | 3300042615 | Bacteria | 35763 |
| 201 | Ga0466715_038354 | 3300042616 | Bacteria | 15131 |
| 202 | Ga0466715_083165 | 3300042616 | Bacteria | 15895 |
| 203 | Ga0466726_368666 | 3300042619 | Bacteria | 3433 |
| 204 | Ga0466706_017038 | 3300042599 | Bacteria | 50770 |
| 205 | Ga0466707_331712 | 3300042601 | Bacteria | 2847 |
| 206 | Ga0466713_053013 | 3300042602 | Bacteria | 1816 |
| 207 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 208 | Ga0466713_104587 | 3300042602 | Bacteria | 60209 |
| 209 | Ga0466714_057554 | 3300042603 | Bacteria | 76415 |
| 210 | Ga0466719_068036 | 3300042606 | Unclassified | 1817 |
| 211 | Ga0466722_205061 | 3300042609 | Bacteria | 22162 |
| 212 | Ga0466729_209867 | 3300042621 | Bacteria | 12719 |
| 213 | Ga0466704_143483 | 3300042643 | Bacteria | 8895 |
| 214 | Ga0466704_160374 | 3300042643 | Bacteria | 25736 |
| 215 | Ga0466704_459707 | 3300042643 | Bacteria | 4349 |
| 216 | Ga0466727_010719 | 3300042655 | Bacteria | 5533 |
| 217 | Ga0466727_012285 | 3300042655 | Bacteria | 78596 |
| 218 | Ga0466727_107621 | 3300042655 | Bacteria | 9293 |
| 219 | Ga0466727_229944 | 3300042655 | Bacteria | 5448 |
| 220 | Ga0160472_100008 | 3300012839 | Bacteria | 546040 |
| 221 | Ga0466690_022508 | 3300042590 | Bacteria | 6990 |
| 222 | 2227069676 | 2225789003 | Bacteria | 14041 |
| 223 | 2227652398 | 2225789004 | Bacteria | 10756 |
| 224 | Meta3P_1000330 | 3300002464 | Bacteria | 26448 |
| 225 | Ga0068305_10002051 | 3300005083 | Bacteria | 12918 |
| 226 | Ga0466705_057535 | 3300042612 | Unclassified | 2515 |
| 227 | Ga0466705_163322 | 3300042612 | Bacteria | 155241 |
| 228 | Ga0466705_378213 | 3300042612 | Bacteria | 34876 |
| 229 | Ga0466733_129366 | 3300042659 | Bacteria | 3951 |
| 230 | Ga0466723_140287 | 3300042618 | Bacteria | 17151 |
| 231 | Ga0466726_052848 | 3300042619 | Bacteria | 9696 |
| 232 | Ga0466726_057783 | 3300042619 | Bacteria | 3330 |
| 233 | Ga0466728_432332 | 3300042620 | Bacteria | 2089 |
| 234 | Ga0466729_070843 | 3300042621 | Bacteria | 12856 |
| 235 | Ga0466729_185954 | 3300042621 | Bacteria | 9191 |
| 236 | Ga0466706_040366 | 3300042599 | Bacteria | 3942 |
| 237 | Ga0466713_077572 | 3300042602 | Bacteria | 13878 |
| 238 | Ga0466714_002319 | 3300042603 | Bacteria | 2523 |
| 239 | Ga0466714_024813 | 3300042603 | Bacteria | 7662 |
| 240 | Ga0466714_084701 | 3300042603 | Bacteria | 2541 |
| 241 | Ga0466716_142592 | 3300042605 | Bacteria | 5252 |
| 242 | Ga0466720_133270 | 3300042607 | Bacteria | 4943 |
| 243 | Ga0466722_049838 | 3300042609 | Bacteria | 2949 |
| 244 | Ga0466729_265448 | 3300042621 | Bacteria | 1891 |
| 245 | Ga0466735_019134 | 3300042624 | Bacteria | 12294 |
| 246 | Ga0466735_057967 | 3300042624 | Bacteria | 11793 |
| 247 | Ga0466730_034269 | 3300042625 | Bacteria | 7054 |
| 248 | Ga0466703_043437 | 3300042636 | Bacteria | 8263 |
| 249 | Ga0466703_187956 | 3300042636 | Bacteria | 10003 |
| 250 | Ga0466704_152669 | 3300042643 | Bacteria | 16639 |
| 251 | Ga0466704_217687 | 3300042643 | Bacteria | 53708 |
| 252 | Ga0466724_25433 | 3300042649 | Bacteria | 649431 |
| 253 | Ga0466708_367530 | 3300042652 | Bacteria | 33206 |
| 254 | Ga0466727_293953 | 3300042655 | Bacteria | 80331 |
| 255 | Ga0123354_10066467 | 3300010882 | Bacteria | 5264 |
| 256 | Ga0265387_1000217 | 3300024582 | Bacteria | 10028 |
| 257 | Ga0265387_1004130 | 3300024582 | Bacteria | 1986 |
| 258 | Ga0466690_038482 | 3300042590 | Bacteria | 44603 |
| 259 | Ga0466691_099030 | 3300042593 | Bacteria | 8673 |
| 260 | DPO_contig07294 | 2032320009 | Bacteria | 27646 |
| 261 | FGTW_contig18636 | 2065487013 | Unclassified | 7300 |
| 262 | IMNBL1DRAFT_c0000358 | 3300000062 | Bacteria | 38656 |
| 263 | JGI24699J35502_11134160 | 3300002509 | Bacteria | 40832 |
| 264 | Ga0068302_10044430 | 3300005071 | Bacteria | 7508 |
| 265 | Ga0068305_10000079 | 3300005083 | Bacteria | 163717 |
| 266 | Ga0104050_1001294 | 3300007153 | Unclassified | 21000 |
| 267 | Ga0103264_1000008 | 3300007188 | Bacteria | 140843 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07690 | MFS_1 | Major Facilitator Superfamily | 98 | 493 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.