Protein Family IF05666
Metagenome
Isolate
201
Members
75
Samples
182
Scaffolds
239.71
Avg Length
Representative Sequence
- ID
- 3300042599|Ga0466706_208277|Ga0466706_208277_8348_9175
- Length
- 275 aa
- Sequence
- MKCKYPIFFHNTRSVTLLFVLLPQSNYLMTQLSVNINKIATLRNARGGDIPNVVRVALDCERFGADGITVHPRPDERHIRKSDVYDLRPLLHTELNIEGYPSPEFIDLVLKVKPHQVTLVPDSPEQITSNAGWDTVTHQAFLTEVLDRFKNAGIRTSVFVAADPMMVEHAANAGADRVELYTEPYALMYPENPEAAVAPFVKAGEVARKLGLGLNAGHDLNLHNLHYLYQNIHWLDEVSIGHSLISDALYLGLERTVKAYKNCLQPNPRTLDANY
Sample Types
Isolate
9.4%
Metagenome
90.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.9%
Kalotermitidae
19.4%
Unclassified
15.3%
Blattidae
11.1%
Termopsidae
5.6%
Passalidae
4.2%
Culicidae
1.4%
Hodotermitidae
1.4%
Elmidae
1.4%
Lamproblattidae
1.4%
Taxonomy
Archaea
0
Bacteria
182
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 9 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 10 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 18 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 19 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 28 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 29 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 30 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 36 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 37 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 42 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 43 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 44 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 45 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 46 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 47 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 48 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 49 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 50 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 51 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 53 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 56 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 57 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 58 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 59 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 60 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 61 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 62 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 63 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 64 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 65 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 66 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 67 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 68 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 71 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 72 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 73 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 74 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 75 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_036566 | 3300042615 | Bacteria | 2493 |
| 2 | Ga0466711_131421 | 3300042615 | Bacteria | 29142 |
| 3 | Ga0466715_032215 | 3300042616 | Bacteria | 1978 |
| 4 | Ga0466715_111008 | 3300042616 | Bacteria | 3976 |
| 5 | Ga0466715_269094 | 3300042616 | Bacteria | 6359 |
| 6 | Ga0466728_161024 | 3300042620 | Bacteria | 7177 |
| 7 | Ga0265387_1004088 | 3300024582 | Unclassified | 1997 |
| 8 | Ga0415639_199669 | 3300038395 | Bacteria | 2848 |
| 9 | Ga0466694_118839 | 3300042594 | Bacteria | 1113 |
| 10 | IMNBGM34_c000072 | 3300000036 | Bacteria | 28080 |
| 11 | IMNBL1DRAFT_c0026930 | 3300000062 | Bacteria | 2174 |
| 12 | JGI24702J35022_10048283 | 3300002462 | Unclassified | 2266 |
| 13 | Ga0068302_10020160 | 3300005071 | Bacteria | 6074 |
| 14 | Ga0072940_1134040 | 3300005200 | Bacteria | 3168 |
| 15 | Ga0466714_078115 | 3300042603 | Bacteria | 1256 |
| 16 | Ga0466716_133964 | 3300042605 | Bacteria | 5821 |
| 17 | Ga0123356_10647271 | 3300010049 | Bacteria | 1224 |
| 18 | Ga0123353_10165408 | 3300010167 | Bacteria | 3516 |
| 19 | Ga0123353_10270405 | 3300010167 | Unclassified | 2619 |
| 20 | Ga0466735_104077 | 3300042624 | Bacteria | 2705 |
| 21 | Ga0466735_224690 | 3300042624 | Bacteria | 1668 |
| 22 | Ga0466708_050839 | 3300042652 | Bacteria | 8235 |
| 23 | Ga0466705_243733 | 3300042612 | Bacteria | 1111 |
| 24 | Ga0466733_023895 | 3300042659 | Bacteria | 2979 |
| 25 | Ga0160459_108728 | 3300012831 | Bacteria | 1242 |
| 26 | Ga0466701_006576 | 3300042598 | Bacteria | 2075 |
| 27 | IMNBL1DRAFT_c0003600 | 3300000062 | Bacteria | 9824 |
| 28 | JGI24696J40584_12937771 | 3300002834 | Bacteria | 1611 |
| 29 | Ga0466706_042294 | 3300042599 | Bacteria | 18010 |
| 30 | Ga0466706_215814 | 3300042599 | Bacteria | 4268 |
| 31 | Ga0466706_245575 | 3300042599 | Bacteria | 8556 |
| 32 | Ga0466714_057554 | 3300042603 | Bacteria | 76415 |
| 33 | Ga0466719_507388 | 3300042606 | Bacteria | 5599 |
| 34 | Ga0123353_10863104 | 3300010167 | Bacteria | 1238 |
| 35 | Ga0466735_030183 | 3300042624 | Bacteria | 11567 |
| 36 | Ga0466732_080661 | 3300042656 | Bacteria | 5256 |
| 37 | Ga0466733_220429 | 3300042659 | Bacteria | 5014 |
| 38 | Ga0466710_330391 | 3300042613 | Bacteria | 1317 |
| 39 | Ga0466710_349633 | 3300042613 | Bacteria | 2661 |
| 40 | Ga0466711_028027 | 3300042615 | Bacteria | 1745 |
| 41 | Ga0466711_270449 | 3300042615 | Bacteria | 10982 |
| 42 | Ga0466723_210506 | 3300042618 | Bacteria | 54048 |
| 43 | Ga0466657_280103 | 3300042582 | Bacteria | 2233 |
| 44 | Ga0466657_330299 | 3300042582 | Bacteria | 2667 |
| 45 | Ga0466693_250355 | 3300042592 | Bacteria | 3311 |
| 46 | Ga0466694_158924 | 3300042594 | Bacteria | 1731 |
| 47 | Ga0466696_474649 | 3300042596 | Bacteria | 7616 |
| 48 | 2227183574 | 2225789004 | Bacteria | 8038 |
| 49 | IMNBL1DRAFT_c0032872 | 3300000062 | Bacteria | 1865 |
| 50 | JGI24696J40584_12947558 | 3300002834 | Bacteria | 1954 |
| 51 | Ga0072941_1006903 | 3300005201 | Bacteria | 9773 |
| 52 | Ga0466701_028239 | 3300042598 | Bacteria | 3468 |
| 53 | Ga0466706_074970 | 3300042599 | Bacteria | 5323 |
| 54 | Ga0466706_075646 | 3300042599 | Unclassified | 6629 |
| 55 | Ga0466706_144964 | 3300042599 | Bacteria | 38907 |
| 56 | Ga0466713_038303 | 3300042602 | Bacteria | 10607 |
| 57 | Ga0466714_070556 | 3300042603 | Unclassified | 1414 |
| 58 | Ga0466719_541389 | 3300042606 | Bacteria | 6000 |
| 59 | Ga0123356_10003850 | 3300010049 | Bacteria | 15626 |
| 60 | Ga0123356_10146736 | 3300010049 | Bacteria | 2335 |
| 61 | Ga0123356_10164515 | 3300010049 | Bacteria | 2221 |
| 62 | Ga0466731_107022 | 3300042622 | Bacteria | 50730 |
| 63 | Ga0466731_112674 | 3300042622 | Bacteria | 1739 |
| 64 | Ga0466703_072373 | 3300042636 | Bacteria | 1661 |
| 65 | Ga0466697_169405 | 3300042611 | Unclassified | 4654 |
| 66 | Ga0466697_209884 | 3300042611 | Bacteria | 1369 |
| 67 | Ga0466733_075081 | 3300042659 | Bacteria | 1513 |
| 68 | Ga0466711_335093 | 3300042615 | Bacteria | 2752 |
| 69 | Ga0466691_060045 | 3300042593 | Bacteria | 38473 |
| 70 | JGI24702J35022_10000587 | 3300002462 | Bacteria | 22066 |
| 71 | JGI24705J35276_12215013 | 3300002504 | Bacteria | 1984 |
| 72 | Ga0072941_1112367 | 3300005201 | Bacteria | 7025 |
| 73 | Ga0123357_10000528 | 3300009784 | Bacteria | 37495 |
| 74 | Ga0466701_073656 | 3300042598 | Bacteria | 1436 |
| 75 | Ga0466706_031709 | 3300042599 | Bacteria | 16740 |
| 76 | Ga0466706_060433 | 3300042599 | Bacteria | 6838 |
| 77 | Ga0466706_105381 | 3300042599 | Bacteria | 10744 |
| 78 | Ga0466706_249268 | 3300042599 | Bacteria | 84594 |
| 79 | Ga0466700_300134 | 3300042600 | Bacteria | 1449 |
| 80 | Ga0466707_053215 | 3300042601 | Bacteria | 10788 |
| 81 | Ga0466713_109671 | 3300042602 | Bacteria | 2968 |
| 82 | Ga0466714_038268 | 3300042603 | Bacteria | 9295 |
| 83 | Ga0123356_10276718 | 3300010049 | Unclassified | 1771 |
| 84 | Ga0466735_076572 | 3300042624 | Bacteria | 3429 |
| 85 | Ga0466735_132481 | 3300042624 | Bacteria | 8717 |
| 86 | Ga0466724_58246 | 3300042649 | Bacteria | 1335 |
| 87 | Ga0466708_073608 | 3300042652 | Bacteria | 19362 |
| 88 | Ga0466727_028598 | 3300042655 | Bacteria | 1481 |
| 89 | Ga0466733_108832 | 3300042659 | Bacteria | 18233 |
| 90 | Ga0466715_122375 | 3300042616 | Bacteria | 9570 |
| 91 | Ga0466715_552206 | 3300042616 | Unclassified | 1471 |
| 92 | Ga0466656_086426 | 3300042550 | Bacteria | 17058 |
| 93 | Ga0466696_386469 | 3300042596 | Bacteria | 7997 |
| 94 | JGI24702J35022_10005072 | 3300002462 | Bacteria | 7754 |
| 95 | Ga0072941_1192874 | 3300005201 | Bacteria | 1259 |
| 96 | Ga0072941_1308955 | 3300005201 | Bacteria | 1145 |
| 97 | Ga0466706_020157 | 3300042599 | Bacteria | 37693 |
| 98 | Ga0466706_040605 | 3300042599 | Unclassified | 3034 |
| 99 | Ga0466707_157789 | 3300042601 | Bacteria | 1015 |
| 100 | Ga0466713_022551 | 3300042602 | Bacteria | 8985 |
| 101 | Ga0466713_124643 | 3300042602 | Bacteria | 27149 |
| 102 | Ga0466721_287999 | 3300042608 | Bacteria | 1216 |
| 103 | Ga0123356_10080423 | 3300010049 | Unclassified | 3081 |
| 104 | Ga0466735_072484 | 3300042624 | Bacteria | 2139 |
| 105 | Ga0466735_164425 | 3300042624 | Bacteria | 1945 |
| 106 | Ga0466704_292263 | 3300042643 | Bacteria | 19195 |
| 107 | Ga0466708_024802 | 3300042652 | Unclassified | 3503 |
| 108 | Ga0466697_132000 | 3300042611 | Unclassified | 1085 |
| 109 | Ga0466705_086320 | 3300042612 | Bacteria | 10935 |
| 110 | Ga0466733_094214 | 3300042659 | Bacteria | 13671 |
| 111 | Ga0466733_147808 | 3300042659 | Bacteria | 2013 |
| 112 | Ga0466715_215776 | 3300042616 | Bacteria | 39785 |
| 113 | Ga0466715_239461 | 3300042616 | Bacteria | 4791 |
| 114 | Ga0466723_094398 | 3300042618 | Bacteria | 5285 |
| 115 | Ga0466690_013866 | 3300042590 | Bacteria | 3894 |
| 116 | Ga0466691_022019 | 3300042593 | Bacteria | 3890 |
| 117 | Ga0466694_050634 | 3300042594 | Bacteria | 2262 |
| 118 | Ga0466695_299417 | 3300042595 | Bacteria | 4586 |
| 119 | IMNBL1DRAFT_c0000735 | 3300000062 | Bacteria | 25981 |
| 120 | AustNasuHG_c1028930 | 3300000089 | Bacteria | 1640 |
| 121 | JGI24702J35022_10000040 | 3300002462 | Bacteria | 53566 |
| 122 | Ga0068305_10015353 | 3300005083 | Bacteria | 31632 |
| 123 | Ga0466706_024312 | 3300042599 | Bacteria | 11922 |
| 124 | Ga0466706_094705 | 3300042599 | Bacteria | 26280 |
| 125 | Ga0466706_103812 | 3300042599 | Bacteria | 57157 |
| 126 | Ga0466706_128935 | 3300042599 | Bacteria | 12762 |
| 127 | Ga0466706_173658 | 3300042599 | Bacteria | 2630 |
| 128 | Ga0466707_275884 | 3300042601 | Bacteria | 4141 |
| 129 | Ga0466714_047865 | 3300042603 | Bacteria | 7855 |
| 130 | Ga0466714_064194 | 3300042603 | Bacteria | 2258 |
| 131 | Ga0466714_082543 | 3300042603 | Bacteria | 1646 |
| 132 | Ga0466714_159432 | 3300042603 | Bacteria | 1204 |
| 133 | Ga0466717_259698 | 3300042604 | Bacteria | 1438 |
| 134 | Ga0123355_10000781 | 3300009826 | Bacteria | 43504 |
| 135 | Ga0123356_10272475 | 3300010049 | Bacteria | 1783 |
| 136 | Ga0123353_10000348 | 3300010167 | Bacteria | 56584 |
| 137 | Ga0123353_10065347 | 3300010167 | Bacteria | 5840 |
| 138 | Ga0466735_177709 | 3300042624 | Bacteria | 2191 |
| 139 | Ga0466735_207966 | 3300042624 | Bacteria | 1481 |
| 140 | Ga0466709_113499 | 3300042648 | Bacteria | 4543 |
| 141 | Ga0466727_326225 | 3300042655 | Bacteria | 66208 |
| 142 | Ga0466733_184846 | 3300042659 | Bacteria | 4413 |
| 143 | Ga0466710_312501 | 3300042613 | Unclassified | 3182 |
| 144 | Ga0466728_282666 | 3300042620 | Bacteria | 52404 |
| 145 | Ga0466690_129175 | 3300042590 | Bacteria | 2045 |
| 146 | Ga0466690_208631 | 3300042590 | Bacteria | 2677 |
| 147 | Ga0466694_375559 | 3300042594 | Bacteria | 1108 |
| 148 | JGI24702J35022_10008109 | 3300002462 | Bacteria | 5978 |
| 149 | JGI24705J35276_12234362 | 3300002504 | Bacteria | 5455 |
| 150 | Ga0068305_10007593 | 3300005083 | Bacteria | 80483 |
| 151 | Ga0466701_071754 | 3300042598 | Bacteria | 32901 |
| 152 | Ga0466706_191798 | 3300042599 | Bacteria | 2325 |
| 153 | Ga0466706_208277 | 3300042599 | Bacteria | 46151 |
| 154 | Ga0466706_240401 | 3300042599 | Bacteria | 2057 |
| 155 | Ga0466714_090767 | 3300042603 | Bacteria | 4678 |
| 156 | Ga0466720_184095 | 3300042607 | Bacteria | 5051 |
| 157 | Ga0123353_10000322 | 3300010167 | Bacteria | 59157 |
| 158 | Ga0123353_10124653 | 3300010167 | Unclassified | 4140 |
| 159 | Ga0466735_227364 | 3300042624 | Unclassified | 1120 |
| 160 | Ga0466705_119480 | 3300042612 | Bacteria | 6399 |
| 161 | Ga0466732_157443 | 3300042656 | Bacteria | 61402 |
| 162 | Ga0466733_054172 | 3300042659 | Unclassified | 4430 |
| 163 | Ga0466712_005305 | 3300042614 | Unclassified | 2803 |
| 164 | Ga0466715_036040 | 3300042616 | Bacteria | 2454 |
| 165 | Ga0466723_255058 | 3300042618 | Bacteria | 18460 |
| 166 | Ga0466726_029223 | 3300042619 | Bacteria | 7682 |
| 167 | Ga0466690_167594 | 3300042590 | Unclassified | 12845 |
| 168 | Ga0466695_051672 | 3300042595 | Bacteria | 1565 |
| 169 | Ga0068302_10069121 | 3300005071 | Bacteria | 4330 |
| 170 | Ga0072941_1206478 | 3300005201 | Bacteria | 2521 |
| 171 | Ga0466700_064966 | 3300042600 | Bacteria | 1080 |
| 172 | Ga0466714_056569 | 3300042603 | Bacteria | 26688 |
| 173 | Ga0466714_065187 | 3300042603 | Bacteria | 6458 |
| 174 | Ga0123357_10024305 | 3300009784 | Bacteria | 8155 |
| 175 | Ga0123357_10334627 | 3300009784 | Bacteria | 1474 |
| 176 | Ga0466735_109871 | 3300042624 | Unclassified | 3596 |
| 177 | Ga0466735_147410 | 3300042624 | Bacteria | 1851 |
| 178 | Ga0466735_191368 | 3300042624 | Bacteria | 1302 |
| 179 | Ga0466735_209754 | 3300042624 | Bacteria | 3845 |
| 180 | Ga0466703_247438 | 3300042636 | Bacteria | 6441 |
| 181 | Ga0466709_289091 | 3300042648 | Bacteria | 34959 |
| 182 | Ga0466708_080566 | 3300042652 | Bacteria | 94583 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03740 | PdxJ | Pyridoxal phosphate biosynthesis protein PdxJ | 31 | 263 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.