Protein Family IF05648

Metagenome Metatranscriptome Isolate
170 Members
51 Samples
167 Scaffolds
315.33 Avg Length

🧬 Representative Sequence

ID
3300042599|Ga0466706_181726|Ga0466706_181726_364_1407
Length
347 aa
Sequence
MSLAKRELIEGEIKRLQSKTGLPMKTLLKYGGIPVRTWNDWQCRCGLPTKHNNNIPRAYYLTPEEVLAIVEYCQDNNEDGIKGYRMLTYEMIDKDIAYASPSSVYNVLKRHNFFKKWACNTENGNTSKRGFDQPACIHEQWHIDFSYIKVCGVFYYFICVFDGYSRRVLNWKLCLSMEGINAEVIIAETKEMYPEAVSPRLISDNGAQFVSHDFAELLVYLEIGHTCTSPAHPQSNGKLERFHRTWKTENVRTSAFIGYEDAVKQIGEWIDYYNSKRLHSAINYLTPDDIFYGRNKERLAQRTEKLYNAKVARQNYWLTQQTAKSSYKLDSKIASSAWVGQCDAGFL

📊 Sample Types

Isolate 1.8%
Metagenome 97.7%
MAG 0.0%
Metatranscriptome 0.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 70.0%
Unclassified 10.0%
Kalotermitidae 8.0%
Termopsidae 8.0%
Hodotermitidae 2.0%
Rhinotermitidae 2.0%

🌳 Taxonomy

Archaea 1
Bacteria 157
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2228664018 Amitermes wheeleri hindgut microbial communities from Arizona, USA - 3 Metagenome Termitidae
2 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
15 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
18 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
19 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
22 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
23 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
30 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
31 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
32 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
33 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
36 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
42 2820018428 Unclassified Spirochaetes Nt197P3bin33 Isolate Unclassified
43 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
44 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
45 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
46 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
47 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
48 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
49 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24695J34938_10059493 3300002450 Bacteria 1634
2 JGI24702J35022_10026494 3300002462 Bacteria 3122
3 JGI24702J35022_10096758 3300002462 Bacteria 1612
4 JGI24702J35022_10201491 3300002462 Bacteria 1139
5 Ga0466732_180097 3300042656 Bacteria 1837
6 Ga0466731_267263 3300042622 Bacteria 1640
7 Ga0466718_155964 3300042617 Bacteria 2014
8 Ga0466701_023106 3300042598 Bacteria 2095
9 Ga0466706_089891 3300042599 Bacteria 2142
10 Ga0466717_018985 3300042604 Bacteria 1490
11 Ga0466720_118691 3300042607 Bacteria 1530
12 Ga0466698_512133 3300042610 Bacteria 1556
13 Ga0415639_025894 3300038395 Bacteria 1274
14 Ga0466656_312729 3300042550 Bacteria 1366
15 Ga0466693_194836 3300042592 Bacteria 2682
16 Ga0466693_244727 3300042592 Bacteria 1410
17 Ga0466694_016842 3300042594 Bacteria 1807
18 Ga0466694_083155 3300042594 Bacteria 1178
19 Ga0466699_021861 3300042597 Bacteria 10135
20 JGI24696J40584_12933699 3300002834 Bacteria 1525
21 JGI24696J40584_12937941 3300002834 Bacteria 1615
22 Ga0123357_10167536 3300009784 Bacteria 2611
23 Ga0123356_10092915 3300010049 Bacteria 2878
24 Ga0466731_037519 3300042622 Bacteria 1194
25 Ga0466731_075769 3300042622 Bacteria 1955
26 Ga0466731_303868 3300042622 Bacteria 1838
27 Ga0466735_078157 3300042624 Bacteria 1778
28 Ga0466702_192088 3300042635 Bacteria 1374
29 Ga0466702_311951 3300042635 Bacteria 1176
30 Ga0466725_001989 3300042654 Bacteria 1705
31 Ga0466710_042366 3300042613 Bacteria 1591
32 Ga0466700_153245 3300042600 Bacteria 1747
33 Ga0466720_209756 3300042607 Bacteria 1531
34 Ga0466720_221020 3300042607 Bacteria 1275
35 Ga0466721_102200 3300042608 Bacteria 2256
36 Ga0255809_1005286 3300022820 Bacteria 2143
37 Ga0466693_041909 3300042592 Bacteria 1391
38 Ga0466693_110249 3300042592 Bacteria 1062
39 Ga0466694_047000 3300042594 Bacteria 2149
40 Ga0466694_344845 3300042594 Bacteria 10641
41 Ga0466699_056190 3300042597 Bacteria 4749
42 Ga0466699_190579 3300042597 Bacteria 1693
43 JGI24695J34938_10072751 3300002450 Bacteria 1433
44 JGI24702J35022_10126863 3300002462 Bacteria 1413
45 Ga0068302_10028471 3300005071 Bacteria 1406
46 Ga0466705_100784 3300042612 Bacteria 1743
47 Ga0123356_10217970 3300010049 Bacteria 1962
48 Ga0123356_10286763 3300010049 Bacteria 1745
49 Ga0123356_10343150 3300010049 Bacteria 1614
50 Ga0123356_10845478 3300010049 Bacteria 1086
51 Ga0123354_10276735 3300010882 Bacteria 1639
52 Ga0466731_049400 3300042622 Bacteria 1472
53 Ga0466731_057741 3300042622 Bacteria 1761
54 Ga0466727_102747 3300042655 Bacteria 1716
55 Ga0466711_432861 3300042615 Bacteria 1895
56 Ga0466718_034062 3300042617 Bacteria 1233
57 Ga0466726_022448 3300042619 Unclassified 2504
58 Ga0466726_226560 3300042619 Unclassified 1277
59 Ga0466701_101868 3300042598 Bacteria 1955
60 Ga0466706_228268 3300042599 Bacteria 1732
61 Ga0466720_209715 3300042607 Bacteria 12238
62 Ga0466721_263944 3300042608 Bacteria 1689
63 Ga0466657_271226 3300042582 Bacteria 1108
64 Ga0466694_086504 3300042594 Bacteria 1665
65 Ga0466694_110712 3300042594 Bacteria 1569
66 Ga0466694_407178 3300042594 Bacteria 1452
67 JGI24695J34938_10059187 3300002450 Bacteria 1640
68 JGI24695J34938_10074111 3300002450 Bacteria 1417
69 JGI24702J35022_10103122 3300002462 Unclassified 1563
70 Ga0074263_105742 3300005485 Bacteria 2196
71 Ga0123357_10347701 3300009784 Bacteria 1423
72 Ga0123353_10394092 3300010167 Bacteria 2064
73 Ga0466702_349548 3300042635 Bacteria 1261
74 Ga0466725_198708 3300042654 Bacteria 1397
75 Ga0466727_293862 3300042655 Bacteria 1289
76 Ga0466726_252216 3300042619 Bacteria 1588
77 Ga0466726_355095 3300042619 Bacteria 1385
78 Ga0466701_041985 3300042598 Bacteria 1609
79 Ga0466707_184952 3300042601 Bacteria 1154
80 Ga0466719_271861 3300042606 Bacteria 1981
81 Ga0466721_079585 3300042608 Bacteria 1554
82 Ga0466656_351265 3300042550 Bacteria 2131
83 Ga0466694_304203 3300042594 Unclassified 1572
84 Ga0466699_342850 3300042597 Bacteria 1092
85 JGI24698J34947_10087539 3300002449 Bacteria 1440
86 JGI24695J34938_10078956 3300002450 Bacteria 1362
87 Ga0074263_106925 3300005485 Bacteria 1514
88 Ga0074263_116546 3300005485 Bacteria 2623
89 Ga0466697_135555 3300042611 Bacteria 1045
90 Ga0466697_154225 3300042611 Bacteria 1762
91 Ga0123355_10507584 3300009826 Bacteria 1483
92 Ga0123356_10210230 3300010049 Bacteria 1994
93 Ga0123356_10271130 3300010049 Bacteria 1787
94 Ga0123356_10311163 3300010049 Bacteria 1684
95 Ga0123353_10388689 3300010167 Bacteria 2083
96 Ga0123353_10545516 3300010167 Bacteria 1674
97 Ga0123354_10195170 3300010882 Bacteria 2249
98 Ga0466734_074430 3300042623 Bacteria 1567
99 Ga0466703_104018 3300042636 Bacteria 4096
100 Ga0466710_139492 3300042613 Bacteria 1327
101 Ga0466710_214605 3300042613 Bacteria 1532
102 Ga0466712_001507 3300042614 Bacteria 2552
103 Ga0466718_024898 3300042617 Bacteria 1525
104 Ga0466706_181726 3300042599 Bacteria 1625
105 Ga0466700_471575 3300042600 Bacteria 1436
106 Ga0466707_207854 3300042601 Bacteria 1657
107 Ga0466721_145846 3300042608 Bacteria 1516
108 Ga0466698_352215 3300042610 Bacteria 3304
109 Ga0466656_240198 3300042550 Bacteria 1597
110 Ga0466695_346916 3300042595 Bacteria 1100
111 Ga0466699_017757 3300042597 Bacteria 14714
112 JGI24698J34947_10070766 3300002449 Bacteria 1677
113 JGI24702J35022_10020639 3300002462 Unclassified 3575
114 JGI24702J35022_10065296 3300002462 Bacteria 1952
115 Ga0074263_118032 3300005485 Unclassified 2026
116 Ga0466731_202523 3300042622 Bacteria 1565
117 Ga0466731_204053 3300042622 Bacteria 1354
118 Ga0466731_253674 3300042622 Bacteria 1468
119 Ga0466702_434958 3300042635 Bacteria 1106
120 Ga0466725_025713 3300042654 Bacteria 1983
121 Ga0466712_063888 3300042614 Bacteria 1947
122 Ga0466729_004573 3300042621 Bacteria 3303
123 Ga0466706_107213 3300042599 Bacteria 1816
124 Ga0466721_064247 3300042608 Bacteria 1529
125 Ga0415639_000926 3300038395 Bacteria 1377
126 AmiMGMT1_c412478 2228664018 Bacteria 976
127 JGI24695J34938_10072307 3300002450 Bacteria 1439
128 Ga0074263_118534 3300005485 Bacteria 1777
129 Ga0123356_10122856 3300010049 Unclassified 2529
130 Ga0123356_10246923 3300010049 Unclassified 1860
131 Ga0123353_10296205 3300010167 Bacteria 2473
132 Ga0123354_10245141 3300010882 Bacteria 1832
133 Ga0466731_281016 3300042622 Bacteria 1707
134 Ga0466731_316568 3300042622 Bacteria 1549
135 Ga0466702_322409 3300042635 Archaea 1543
136 Ga0466712_161345 3300042614 Bacteria 2105
137 Ga0466726_253060 3300042619 Bacteria 1947
138 Ga0466701_033423 3300042598 Bacteria 2030
139 Ga0466698_225672 3300042610 Bacteria 1931
140 Ga0264413_101452 3300024493 Bacteria 1371
141 Ga0415639_000927 3300038395 Unclassified 1369
142 Ga0466694_196903 3300042594 Bacteria 1602
143 JGI24702J35022_10128084 3300002462 Bacteria 1407
144 Ga0068305_10002949 3300005083 Bacteria 6622
145 Ga0074263_118033 3300005485 Bacteria 1502
146 Ga0123356_10217228 3300010049 Unclassified 1966
147 Ga0123356_10291310 3300010049 Bacteria 1733
148 Ga0123356_10304039 3300010049 Bacteria 1701
149 Ga0123353_10592060 3300010167 Bacteria 1588
150 Ga0123353_10752960 3300010167 Bacteria 1355
151 Ga0123354_10268503 3300010882 Bacteria 1685
152 Ga0123354_10329505 3300010882 Bacteria 1394
153 Ga0466731_031538 3300042622 Bacteria 1419
154 Ga0466731_227781 3300042622 Bacteria 1902
155 Ga0466734_014518 3300042623 Bacteria 1431
156 Ga0466724_06195 3300042649 Unclassified 1514
157 Ga0466706_087262 3300042599 Bacteria 1869
158 Ga0466706_187577 3300042599 Unclassified 2055
159 Ga0466713_113580 3300042602 Bacteria 1791
160 Ga0466720_035529 3300042607 Bacteria 1739
161 Ga0466697_028928 3300042611 Bacteria 1607
162 Ga0466656_010783 3300042550 Bacteria 1178
163 Ga0466656_104106 3300042550 Bacteria 1084
164 Ga0466656_364018 3300042550 Bacteria 1554
165 Ga0466693_078609 3300042592 Bacteria 1701
166 Ga0466693_173107 3300042592 Bacteria 1868
167 Ga0466694_058552 3300042594 Bacteria 2476

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 2228664018 AmiMGMT1_c412478 AmiMGMT1_4124781 249
2 3300042594 Ga0466694_110712 Ga0466694_110712_17_802 261
3 3300002450 JGI24695J34938_10059493 JGI24695J34938_100594932 263
4 3300024493 Ga0264413_101452 Ga0264413_1014522 272
5 3300042594 Ga0466694_304203 Ga0466694_304203_100_933 277
6 3300042611 Ga0466697_135555 Ga0466697_135555_153_986 277
7 3300005485 Ga0074263_105742 Ga0074263_1057422 279
8 3300005485 Ga0074263_118033 Ga0074263_1180331 281
9 3300042656 Ga0466732_180097 Ga0466732_180097_961_1818 285
10 3300042599 Ga0466706_089891 Ga0466706_089891_68_934 288
11 3300042597 Ga0466699_056190 Ga0466699_056190_399_1280 293
12 3300042635 Ga0466702_192088 Ga0466702_192088_36_917 293
13 3300042592 Ga0466693_110249 Ga0466693_110249_16_903 295
14 3300042595 Ga0466695_346916 Ga0466695_346916_16_903 295
15 3300042602 Ga0466713_113580 Ga0466713_113580_56_967 303
16 3300042635 Ga0466702_322409 Ga0466702_322409_201_1157 303
17 3300042594 Ga0466694_083155 Ga0466694_083155_114_1028 304
18 3300042594 Ga0466694_058552 Ga0466694_058552_942_1859 305
19 3300042594 Ga0466694_407178 Ga0466694_407178_248_1165 305
20 3300042608 Ga0466721_064247 Ga0466721_064247_118_1074 305
21 3300042622 Ga0466731_037519 Ga0466731_037519_16_933 305
22 3300002462 JGI24702J35022_10201491 JGI24702J35022_102014911 306
23 3300002450 JGI24695J34938_10074111 JGI24695J34938_100741111 307
24 3300042624 Ga0466735_078157 Ga0466735_078157_668_1621 308
25 3300042582 Ga0466657_271226 Ga0466657_271226_138_1094 311
26 3300002462 JGI24702J35022_10128084 JGI24702J35022_101280842 313
27 3300042550 Ga0466656_104106 Ga0466656_104106_12_956 314
28 3300042594 Ga0466694_016842 Ga0466694_016842_168_1112 314
29 3300042622 Ga0466731_057741 Ga0466731_057741_703_1647 314
30 3300042622 Ga0466731_202523 Ga0466731_202523_54_998 314
31 3300010882 Ga0123354_10329505 Ga0123354_103295051 315
32 3300042592 Ga0466693_173107 Ga0466693_173107_459_1406 315
33 3300042654 Ga0466725_198708 Ga0466725_198708_253_1200 315
34 3300010049 Ga0123356_10304039 Ga0123356_103040391 317
35 3300042601 Ga0466707_207854 Ga0466707_207854_474_1427 317
36 3300042619 Ga0466726_022448 Ga0466726_022448_1497_2450 317
37 3300042619 Ga0466726_226560 Ga0466726_226560_55_1008 317
38 3300042622 Ga0466731_253674 Ga0466731_253674_158_1111 317
39 3300042622 Ga0466731_303868 Ga0466731_303868_678_1631 317
40 3300005071 Ga0068302_10028471 Ga0068302_100284712 318
41 3300022820 Ga0255809_1005286 Ga0255809_10052863 318
42 3300038395 Ga0415639_025894 Ga0415639_025894_46_1002 318
43 3300042550 Ga0466656_010783 Ga0466656_010783_195_1151 318
44 3300042550 Ga0466656_240198 Ga0466656_240198_518_1474 318
45 3300042550 Ga0466656_312729 Ga0466656_312729_146_1102 318
46 3300042550 Ga0466656_364018 Ga0466656_364018_455_1411 318
47 3300042592 Ga0466693_078609 Ga0466693_078609_505_1461 318
48 3300042592 Ga0466693_244727 Ga0466693_244727_295_1251 318
49 3300042594 Ga0466694_047000 Ga0466694_047000_862_1818 318
50 3300042594 Ga0466694_086504 Ga0466694_086504_40_996 318
51 3300042594 Ga0466694_196903 Ga0466694_196903_545_1501 318
52 3300042594 Ga0466694_344845 Ga0466694_344845_9634_10590 318
53 3300042597 Ga0466699_017757 Ga0466699_017757_3837_4793 318
54 3300042597 Ga0466699_021861 Ga0466699_021861_9128_10084 318
55 3300042597 Ga0466699_342850 Ga0466699_342850_28_984 318
56 3300042598 Ga0466701_023106 Ga0466701_023106_745_1701 318
57 3300042598 Ga0466701_033423 Ga0466701_033423_568_1524 318
58 3300042599 Ga0466706_087262 Ga0466706_087262_673_1629 318
59 3300042600 Ga0466700_153245 Ga0466700_153245_621_1577 318
60 3300042604 Ga0466717_018985 Ga0466717_018985_436_1392 318
61 3300042606 Ga0466719_271861 Ga0466719_271861_52_1008 318
62 3300042607 Ga0466720_035529 Ga0466720_035529_396_1352 318
63 3300042607 Ga0466720_118691 Ga0466720_118691_442_1398 318
64 3300042607 Ga0466720_209756 Ga0466720_209756_15_971 318
65 3300042607 Ga0466720_221020 Ga0466720_221020_274_1230 318
66 3300042608 Ga0466721_079585 Ga0466721_079585_551_1507 318
67 3300042608 Ga0466721_102200 Ga0466721_102200_808_1764 318
68 3300042608 Ga0466721_145846 Ga0466721_145846_85_1041 318
69 3300042608 Ga0466721_263944 Ga0466721_263944_102_1058 318
70 3300042610 Ga0466698_225672 Ga0466698_225672_652_1608 318
71 3300042610 Ga0466698_352215 Ga0466698_352215_2297_3253 318
72 3300042610 Ga0466698_512133 Ga0466698_512133_439_1395 318
73 3300042611 Ga0466697_028928 Ga0466697_028928_506_1462 318
74 3300042611 Ga0466697_154225 Ga0466697_154225_449_1405 318
75 3300042612 Ga0466705_100784 Ga0466705_100784_491_1447 318
76 3300042613 Ga0466710_139492 Ga0466710_139492_297_1253 318
77 3300042613 Ga0466710_214605 Ga0466710_214605_498_1454 318
78 3300042614 Ga0466712_001507 Ga0466712_001507_1199_2155 318
79 3300042614 Ga0466712_063888 Ga0466712_063888_512_1468 318
80 3300042614 Ga0466712_161345 Ga0466712_161345_364_1320 318
81 3300042617 Ga0466718_024898 Ga0466718_024898_518_1474 318
82 3300042619 Ga0466726_253060 Ga0466726_253060_694_1650 318
83 3300042619 Ga0466726_355095 Ga0466726_355095_293_1249 318
84 3300042622 Ga0466731_031538 Ga0466731_031538_140_1096 318
85 3300042622 Ga0466731_075769 Ga0466731_075769_170_1126 318
86 3300042622 Ga0466731_204053 Ga0466731_204053_233_1189 318
87 3300042622 Ga0466731_267263 Ga0466731_267263_231_1187 318
88 3300042622 Ga0466731_281016 Ga0466731_281016_280_1236 318
89 3300042622 Ga0466731_316568 Ga0466731_316568_195_1151 318
90 3300042623 Ga0466734_014518 Ga0466734_014518_370_1326 318
91 3300042635 Ga0466702_311951 Ga0466702_311951_184_1140 318
92 3300042635 Ga0466702_349548 Ga0466702_349548_86_1042 318
93 3300042635 Ga0466702_434958 Ga0466702_434958_32_988 318
94 3300042654 Ga0466725_001989 Ga0466725_001989_117_1073 318
95 3300042655 Ga0466727_102747 Ga0466727_102747_114_1070 318
96 3300042655 Ga0466727_293862 Ga0466727_293862_170_1126 318
97 iso_pr_bacteria 2820013017 2820014569 318
98 3300002449 JGI24698J34947_10070766 JGI24698J34947_100707661 319
99 3300002449 JGI24698J34947_10087539 JGI24698J34947_100875391 319
100 3300002450 JGI24695J34938_10072751 JGI24695J34938_100727512 319
101 3300002462 JGI24702J35022_10020639 JGI24702J35022_100206391 319
102 3300002462 JGI24702J35022_10026494 JGI24702J35022_100264942 319
103 3300002462 JGI24702J35022_10065296 JGI24702J35022_100652962 319
104 3300002462 JGI24702J35022_10096758 JGI24702J35022_100967582 319
105 3300002462 JGI24702J35022_10103122 JGI24702J35022_101031221 319
106 3300002462 JGI24702J35022_10126863 JGI24702J35022_101268632 319
107 3300002834 JGI24696J40584_12937941 JGI24696J40584_129379413 319
108 3300005485 Ga0074263_106925 Ga0074263_1069252 319
109 3300005485 Ga0074263_116546 Ga0074263_1165462 319
110 3300005485 Ga0074263_118032 Ga0074263_1180323 319
111 3300005485 Ga0074263_118534 Ga0074263_1185342 319
112 3300009784 Ga0123357_10167536 Ga0123357_101675362 319
113 3300009784 Ga0123357_10347701 Ga0123357_103477011 319
114 3300009826 Ga0123355_10507584 Ga0123355_105075842 319
115 3300010049 Ga0123356_10092915 Ga0123356_100929153 319
116 3300010049 Ga0123356_10210230 Ga0123356_102102303 319
117 3300010049 Ga0123356_10217228 Ga0123356_102172282 319
118 3300010049 Ga0123356_10217970 Ga0123356_102179703 319
119 3300010049 Ga0123356_10246923 Ga0123356_102469233 319
120 3300010049 Ga0123356_10271130 Ga0123356_102711301 319
121 3300010049 Ga0123356_10286763 Ga0123356_102867631 319
122 3300010049 Ga0123356_10291310 Ga0123356_102913101 319
123 3300010049 Ga0123356_10311163 Ga0123356_103111632 319
124 3300010049 Ga0123356_10343150 Ga0123356_103431503 319
125 3300010049 Ga0123356_10845478 Ga0123356_108454781 319
126 3300010167 Ga0123353_10388689 Ga0123353_103886892 319
127 3300010167 Ga0123353_10592060 Ga0123353_105920601 319
128 3300010167 Ga0123353_10752960 Ga0123353_107529602 319
129 3300010882 Ga0123354_10195170 Ga0123354_101951703 319
130 3300010882 Ga0123354_10245141 Ga0123354_102451412 319
131 3300010882 Ga0123354_10268503 Ga0123354_102685032 319
132 3300010882 Ga0123354_10276735 Ga0123354_102767351 319
133 3300042617 Ga0466718_155964 Ga0466718_155964_793_1752 319
134 3300002834 JGI24696J40584_12933699 JGI24696J40584_129336992 320
135 3300010167 Ga0123353_10394092 Ga0123353_103940924 320
136 3300010167 Ga0123353_10545516 Ga0123353_105455162 320
137 3300038395 Ga0415639_000927 Ga0415639_000927_381_1343 320
138 3300042592 Ga0466693_041909 Ga0466693_041909_396_1358 320
139 3300042601 Ga0466707_184952 Ga0466707_184952_150_1112 320
140 3300042615 Ga0466711_432861 Ga0466711_432861_787_1749 320
141 3300042621 Ga0466729_004573 Ga0466729_004573_1800_2762 320
142 iso_pr_bacteria 2820018428 2820019627 320
143 iso_pr_bacteria 2820018428 2820019677 320
144 3300010167 Ga0123353_10296205 Ga0123353_102962054 321
145 3300038395 Ga0415639_000926 Ga0415639_000926_390_1355 321
146 3300042598 Ga0466701_101868 Ga0466701_101868_570_1535 321
147 3300042619 Ga0466726_252216 Ga0466726_252216_472_1437 321
148 3300042636 Ga0466703_104018 Ga0466703_104018_1968_2933 321
149 3300042649 Ga0466724_06195 Ga0466724_06195_182_1147 321
150 3300002450 JGI24695J34938_10059187 JGI24695J34938_100591873 322
151 3300002450 JGI24695J34938_10072307 JGI24695J34938_100723072 322
152 3300002450 JGI24695J34938_10078956 JGI24695J34938_100789561 322
153 3300042654 Ga0466725_025713 Ga0466725_025713_522_1490 322
154 3300042600 Ga0466700_471575 Ga0466700_471575_343_1314 323
155 3300005083 Ga0068305_10002949 Ga0068305_100029491 324
156 3300042550 Ga0466656_351265 Ga0466656_351265_836_1810 324
157 3300042592 Ga0466693_194836 Ga0466693_194836_111_1085 324
158 3300042613 Ga0466710_042366 Ga0466710_042366_443_1417 324
159 3300042623 Ga0466734_074430 Ga0466734_074430_402_1376 324
160 3300010049 Ga0123356_10122856 Ga0123356_101228563 325
161 3300042597 Ga0466699_190579 Ga0466699_190579_178_1158 326
162 3300042598 Ga0466701_041985 Ga0466701_041985_159_1139 326
163 3300042599 Ga0466706_107213 Ga0466706_107213_178_1164 328
164 3300042599 Ga0466706_187577 Ga0466706_187577_827_1813 328
165 3300042617 Ga0466718_034062 Ga0466718_034062_212_1201 329
166 3300042622 Ga0466731_049400 Ga0466731_049400_350_1345 331
167 3300042622 Ga0466731_227781 Ga0466731_227781_847_1842 331
168 3300042599 Ga0466706_228268 Ga0466706_228268_591_1589 332
169 3300042607 Ga0466720_209715 Ga0466720_209715_308_1306 332
170 3300042599 Ga0466706_181726 Ga0466706_181726_364_1407 347

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13683 rve_3 Integrase core domain 223 287 0.97
PF13333 rve_2 Integrase core domain 240 287 0.96
PF00665 rve Integrase core domain 138 233 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF13683 GO:0015074 DNA integration BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.