Protein Family IF05445
Metagenome
Isolate
197
Members
79
Samples
170
Scaffolds
275.75
Avg Length
Representative Sequence
- ID
- 3300042598|Ga0466701_024539|Ga0466701_024539_107374_108327
- Length
- 298 aa
- Sequence
- MTKQELFENIKRKNTFLCVGLDTDIKKIPKHLLEEEDPIFAFNKAIIDATVDYCVAFKPNLAFYESLGTKGWISFEKTVQYLREYYPDQFLIADAKRGDIGNTSELYARAFFDEMKVDAVTVAPYMGSDSVKPFLYLMDEHKQYTIPRKGTWTILLALTSNEGADDFQLMFDGASDCHHKLYQKVLRKGKSWATDEQLMFVVGATQTGYLVEIRKIVPDYFLLIPGVGAQGGSLEEVCKYGMNSQCGLLVNNSRQIIYASNGKDFAEAAGQEAKKMQLEMEGLLIKYGRIQLCIANKA
Sample Types
Isolate
13.7%
Metagenome
86.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.6%
Blattidae
19.5%
Kalotermitidae
16.9%
Unclassified
14.3%
Rhinotermitidae
5.2%
Termopsidae
3.9%
Passalidae
3.9%
Hydrophilidae
2.6%
Daphniidae
1.3%
Armadillidiidae
1.3%
Hodotermitidae
1.3%
Tenebrionidae
1.3%
Taxonomy
Archaea
0
Bacteria
193
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 12 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 13 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 14 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 15 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 16 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 17 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 18 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 27 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 34 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 35 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 41 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 42 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 43 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 44 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 45 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 46 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 47 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 48 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 51 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 52 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 53 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 54 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 55 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 56 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 57 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 58 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 59 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 60 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 61 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 62 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 63 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 64 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 65 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 66 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 68 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 69 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 70 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 71 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 72 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 73 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 74 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 75 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 76 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 77 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 78 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 79 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_259914 | 3300042612 | Bacteria | 3119 |
| 2 | Ga0466733_030958 | 3300042659 | Bacteria | 11257 |
| 3 | Ga0466727_060642 | 3300042655 | Bacteria | 26590 |
| 4 | Ga0466727_206812 | 3300042655 | Bacteria | 9489 |
| 5 | Ga0466690_219449 | 3300042590 | Bacteria | 8238 |
| 6 | Ga0466691_148507 | 3300042593 | Bacteria | 9338 |
| 7 | Ga0466694_284888 | 3300042594 | Bacteria | 1534 |
| 8 | Ga0466696_458159 | 3300042596 | Bacteria | 1542 |
| 9 | Ga0123356_10122059 | 3300010049 | Bacteria | 2536 |
| 10 | Ga0123353_10226880 | 3300010167 | Bacteria | 2915 |
| 11 | Ga0123354_10161715 | 3300010882 | Bacteria | 2654 |
| 12 | Ga0466700_466327 | 3300042600 | Bacteria | 6281 |
| 13 | Ga0466707_306665 | 3300042601 | Bacteria | 13988 |
| 14 | Ga0466713_085777 | 3300042602 | Bacteria | 19650 |
| 15 | Ga0466722_051948 | 3300042609 | Bacteria | 11369 |
| 16 | IMNBL1DRAFT_c0009126 | 3300000062 | Bacteria | 4949 |
| 17 | JGI24702J35022_10026635 | 3300002462 | Bacteria | 3113 |
| 18 | JGI24696J40584_12959790 | 3300002834 | Bacteria | 5649 |
| 19 | Ga0466723_050959 | 3300042618 | Bacteria | 22300 |
| 20 | Ga0466726_465351 | 3300042619 | Bacteria | 1609 |
| 21 | Ga0466734_009686 | 3300042623 | Bacteria | 2102 |
| 22 | Ga0466735_223514 | 3300042624 | Bacteria | 1172 |
| 23 | Ga0466709_164902 | 3300042648 | Bacteria | 31389 |
| 24 | Ga0466708_070160 | 3300042652 | Bacteria | 39155 |
| 25 | Ga0466656_312743 | 3300042550 | Bacteria | 3119 |
| 26 | Ga0466657_205657 | 3300042582 | Bacteria | 10730 |
| 27 | Ga0466690_160070 | 3300042590 | Bacteria | 10336 |
| 28 | Ga0123356_10274261 | 3300010049 | Bacteria | 1778 |
| 29 | Ga0123353_10001614 | 3300010167 | Bacteria | 27799 |
| 30 | Ga0123353_10812514 | 3300010167 | Bacteria | 1289 |
| 31 | Ga0123354_10016446 | 3300010882 | Bacteria | 11593 |
| 32 | Ga0466706_160331 | 3300042599 | Bacteria | 28148 |
| 33 | Ga0466707_355815 | 3300042601 | Bacteria | 1429 |
| 34 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 35 | Ga0466714_010558 | 3300042603 | Bacteria | 1221 |
| 36 | JGI24702J35022_10166964 | 3300002462 | Bacteria | 1243 |
| 37 | JGI24699J35502_11134230 | 3300002509 | Bacteria | 99108 |
| 38 | Ga0466711_025258 | 3300042615 | Bacteria | 45468 |
| 39 | Ga0466726_173115 | 3300042619 | Bacteria | 1908 |
| 40 | Ga0466733_005503 | 3300042659 | Bacteria | 3314 |
| 41 | Ga0466733_027595 | 3300042659 | Bacteria | 96004 |
| 42 | Ga0466733_123823 | 3300042659 | Bacteria | 10632 |
| 43 | Ga0466703_348714 | 3300042636 | Bacteria | 36764 |
| 44 | Ga0466703_363700 | 3300042636 | Bacteria | 1952 |
| 45 | Ga0466704_404397 | 3300042643 | Bacteria | 2014 |
| 46 | Ga0466693_273242 | 3300042592 | Bacteria | 1565 |
| 47 | Ga0466691_222074 | 3300042593 | Bacteria | 3328 |
| 48 | Ga0466694_142791 | 3300042594 | Bacteria | 4455 |
| 49 | Ga0466696_241627 | 3300042596 | Bacteria | 18100 |
| 50 | Ga0466700_032177 | 3300042600 | Bacteria | 1050 |
| 51 | Ga0466713_040181 | 3300042602 | Bacteria | 6215 |
| 52 | Ga0466713_077466 | 3300042602 | Bacteria | 18852 |
| 53 | Ga0466714_065131 | 3300042603 | Bacteria | 171349 |
| 54 | IMNBL1DRAFT_c0033041 | 3300000062 | Bacteria | 1858 |
| 55 | Ga0068305_10946871 | 3300005083 | Bacteria | 1476 |
| 56 | Ga0072940_1453426 | 3300005200 | Bacteria | 1271 |
| 57 | Ga0123357_10001874 | 3300009784 | Bacteria | 22834 |
| 58 | Ga0466711_043781 | 3300042615 | Bacteria | 9352 |
| 59 | Ga0466726_055053 | 3300042619 | Bacteria | 11347 |
| 60 | Ga0466728_139106 | 3300042620 | Bacteria | 11729 |
| 61 | Ga0466733_190003 | 3300042659 | Bacteria | 2798 |
| 62 | Ga0466733_209232 | 3300042659 | Bacteria | 28030 |
| 63 | Ga0466735_063520 | 3300042624 | Bacteria | 10049 |
| 64 | Ga0466703_198609 | 3300042636 | Bacteria | 8838 |
| 65 | Ga0265387_1009171 | 3300024582 | Bacteria | 1335 |
| 66 | Ga0466696_346787 | 3300042596 | Bacteria | 4022 |
| 67 | Ga0123357_10005150 | 3300009784 | Bacteria | 15596 |
| 68 | Ga0123355_10000009 | 3300009826 | Bacteria | 191038 |
| 69 | Ga0123353_11047241 | 3300010167 | Bacteria | 1090 |
| 70 | Ga0466713_008762 | 3300042602 | Bacteria | 34128 |
| 71 | Ga0466713_036697 | 3300042602 | Bacteria | 37630 |
| 72 | Ga0466713_097230 | 3300042602 | Bacteria | 35407 |
| 73 | Ga0466714_162103 | 3300042603 | Bacteria | 35358 |
| 74 | Ga0466716_069257 | 3300042605 | Bacteria | 11853 |
| 75 | IMNBL1DRAFT_c0000047 | 3300000062 | Bacteria | 113822 |
| 76 | Ga0068305_10031776 | 3300005083 | Unclassified | 5048 |
| 77 | Ga0123357_10001051 | 3300009784 | Bacteria | 28363 |
| 78 | Ga0466715_601574 | 3300042616 | Bacteria | 17986 |
| 79 | Ga0466726_260216 | 3300042619 | Bacteria | 10848 |
| 80 | Ga0466697_089499 | 3300042611 | Bacteria | 34083 |
| 81 | Ga0466733_121822 | 3300042659 | Bacteria | 48145 |
| 82 | Ga0466734_038665 | 3300042623 | Bacteria | 2752 |
| 83 | Ga0466704_603730 | 3300042643 | Bacteria | 8988 |
| 84 | Ga0466709_294395 | 3300042648 | Bacteria | 3435 |
| 85 | Ga0466690_033586 | 3300042590 | Bacteria | 3505 |
| 86 | Ga0466696_193625 | 3300042596 | Bacteria | 10151 |
| 87 | Ga0466696_271518 | 3300042596 | Bacteria | 4793 |
| 88 | Ga0466701_012723 | 3300042598 | Bacteria | 34655 |
| 89 | Ga0123355_10000036 | 3300009826 | Bacteria | 135537 |
| 90 | Ga0123356_10033300 | 3300010049 | Bacteria | 4819 |
| 91 | Ga0123356_11149870 | 3300010049 | Bacteria | 943 |
| 92 | Ga0123354_10308608 | 3300010882 | Unclassified | 1482 |
| 93 | Ga0466716_418949 | 3300042605 | Bacteria | 41325 |
| 94 | Ga0466698_142555 | 3300042610 | Bacteria | 1464 |
| 95 | IMNBGM34_c006052 | 3300000036 | Bacteria | 1582 |
| 96 | Ga0068305_10164107 | 3300005083 | Bacteria | 1044 |
| 97 | Ga0466705_483013 | 3300042612 | Bacteria | 5437 |
| 98 | Ga0466711_079520 | 3300042615 | Bacteria | 1641 |
| 99 | Ga0466715_254235 | 3300042616 | Bacteria | 13922 |
| 100 | Ga0466723_023862 | 3300042618 | Bacteria | 63714 |
| 101 | Ga0466723_323008 | 3300042618 | Bacteria | 1254 |
| 102 | Ga0466728_247329 | 3300042620 | Bacteria | 15985 |
| 103 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 104 | Ga0466735_028285 | 3300042624 | Bacteria | 8603 |
| 105 | Ga0466735_075577 | 3300042624 | Bacteria | 3915 |
| 106 | Ga0466735_090879 | 3300042624 | Bacteria | 3152 |
| 107 | Ga0466703_006491 | 3300042636 | Bacteria | 10874 |
| 108 | Ga0466704_194858 | 3300042643 | Bacteria | 20469 |
| 109 | Ga0466709_193399 | 3300042648 | Bacteria | 12327 |
| 110 | Ga0466727_194241 | 3300042655 | Bacteria | 4306 |
| 111 | Ga0160469_100004 | 3300012824 | Bacteria | 821419 |
| 112 | Ga0466692_034223 | 3300042591 | Bacteria | 54843 |
| 113 | Ga0466694_179533 | 3300042594 | Bacteria | 1577 |
| 114 | Ga0123357_10415405 | 3300009784 | Unclassified | 1207 |
| 115 | Ga0123354_10095295 | 3300010882 | Bacteria | 4074 |
| 116 | Ga0466700_216390 | 3300042600 | Bacteria | 24849 |
| 117 | Ga0466700_391565 | 3300042600 | Bacteria | 10641 |
| 118 | Ga0466700_470872 | 3300042600 | Bacteria | 3532 |
| 119 | Ga0466700_488783 | 3300042600 | Bacteria | 1525 |
| 120 | Ga0466707_137104 | 3300042601 | Bacteria | 20593 |
| 121 | Ga0466714_150935 | 3300042603 | Bacteria | 85449 |
| 122 | Ga0466716_029364 | 3300042605 | Bacteria | 6213 |
| 123 | Ga0466722_191438 | 3300042609 | Bacteria | 14939 |
| 124 | Ga0466698_149631 | 3300042610 | Bacteria | 1171 |
| 125 | Ga0466698_362079 | 3300042610 | Bacteria | 1334 |
| 126 | 2227555166 | 2225789004 | Bacteria | 14887 |
| 127 | IMNBL1DRAFT_c0032351 | 3300000062 | Bacteria | 1888 |
| 128 | JGI24702J35022_10013427 | 3300002462 | Bacteria | 4538 |
| 129 | JGI24702J35022_10046456 | 3300002462 | Bacteria | 2312 |
| 130 | JGI24702J35022_10077993 | 3300002462 | Bacteria | 1792 |
| 131 | JGI24699J35502_11134232 | 3300002509 | Bacteria | 111679 |
| 132 | Ga0466711_088766 | 3300042615 | Bacteria | 7157 |
| 133 | Ga0466715_456224 | 3300042616 | Bacteria | 6820 |
| 134 | Ga0466728_355270 | 3300042620 | Bacteria | 1179 |
| 135 | Ga0466709_419438 | 3300042648 | Bacteria | 66983 |
| 136 | Ga0466708_050694 | 3300042652 | Bacteria | 2904 |
| 137 | Ga0466690_002912 | 3300042590 | Bacteria | 1162 |
| 138 | Ga0466696_059095 | 3300042596 | Bacteria | 32844 |
| 139 | Ga0123357_10152730 | 3300009784 | Bacteria | 2796 |
| 140 | Ga0123355_10319283 | 3300009826 | Bacteria | 2095 |
| 141 | Ga0123354_10025535 | 3300010882 | Bacteria | 9315 |
| 142 | Ga0123354_10458885 | 3300010882 | Bacteria | 1025 |
| 143 | Ga0466707_017349 | 3300042601 | Bacteria | 1008 |
| 144 | Ga0466707_067819 | 3300042601 | Bacteria | 13397 |
| 145 | Ga0466714_034139 | 3300042603 | Bacteria | 66059 |
| 146 | IMNBGM34_c003071 | 3300000036 | Bacteria | 2342 |
| 147 | IMNBL1DRAFT_c0004870 | 3300000062 | Bacteria | 7892 |
| 148 | Ga0466711_398240 | 3300042615 | Bacteria | 5565 |
| 149 | Ga0466715_434473 | 3300042616 | Bacteria | 7793 |
| 150 | Ga0466728_021535 | 3300042620 | Bacteria | 23157 |
| 151 | Ga0466729_223777 | 3300042621 | Unclassified | 7915 |
| 152 | Ga0466703_149128 | 3300042636 | Bacteria | 1651 |
| 153 | Ga0466704_059760 | 3300042643 | Bacteria | 7903 |
| 154 | Ga0466709_220266 | 3300042648 | Bacteria | 4968 |
| 155 | Ga0466727_271470 | 3300042655 | Bacteria | 12178 |
| 156 | Ga0466690_000575 | 3300042590 | Bacteria | 12614 |
| 157 | Ga0466690_230745 | 3300042590 | Bacteria | 5334 |
| 158 | Ga0466692_021260 | 3300042591 | Bacteria | 27216 |
| 159 | Ga0466695_214883 | 3300042595 | Bacteria | 22622 |
| 160 | Ga0123357_10386034 | 3300009784 | Bacteria | 1293 |
| 161 | Ga0123354_10530502 | 3300010882 | Bacteria | 899 |
| 162 | Ga0466701_024539 | 3300042598 | Bacteria | 142878 |
| 163 | Ga0466701_039977 | 3300042598 | Bacteria | 63641 |
| 164 | Ga0466706_133816 | 3300042599 | Bacteria | 3105 |
| 165 | Ga0466707_052075 | 3300042601 | Bacteria | 8190 |
| 166 | JGI24699J35502_11134031 | 3300002509 | Bacteria | 25636 |
| 167 | Ga0068305_10036704 | 3300005083 | Bacteria | 9267 |
| 168 | Ga0072941_1082782 | 3300005201 | Bacteria | 2550 |
| 169 | Ga0466710_013730 | 3300042613 | Bacteria | 5296 |
| 170 | Ga0466723_265249 | 3300042618 | Bacteria | 1519 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00215 | OMPdecase | Orotidine 5'-phosphate decarboxylase / HUMPS family | 17 | 267 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.