Protein Family IF05377
Metagenome
Metatranscriptome
Isolate
257
Members
61
Samples
248
Scaffolds
119.8
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_440015|Ga0466699_440015_11175_11573
- Length
- 132 aa
- Sequence
- MPRAVDGSKRKEHRKKILKQAKGFWGRRRTNYKTAKDAVTKALFYAYRDRRDRKGDFRKLWIIRINAACREEGLSYSRLIAGLDKAGIIINRKVLAHLAIEDVQAFKAIVAKAKTALGINESTSGNKTADIQ
Sample Types
Isolate
3.5%
Metagenome
90.7%
MAG
0.0%
Metatranscriptome
5.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
58.9%
Unclassified
16.1%
Kalotermitidae
10.7%
Rhinotermitidae
7.1%
Termopsidae
5.4%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
217
Eukaryota
0
Viruses
0
Unclassified
40
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 6 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 7 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 15 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 16 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 17 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
| 25 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 26 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 27 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 30 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 38 | 3300023282 | Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA | Metatranscriptome | Termitidae |
| 39 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 40 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 41 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 48 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 49 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 50 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 51 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 52 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 53 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 54 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 55 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 56 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 59 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 60 | 3300021244 | Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA | Metatranscriptome | Termitidae |
| 61 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | AustNasuHG_c1000740 | 3300000089 | Bacteria | 11605 |
| 2 | AustNasuHG_c1009164 | 3300000089 | Bacteria | 3483 |
| 3 | FAAS_10434068 | 3300001880 | Bacteria | 581 |
| 4 | JGI24698J34947_10002166 | 3300002449 | Bacteria | 10530 |
| 5 | JGI24698J34947_10025898 | 3300002449 | Bacteria | 3119 |
| 6 | JGI24698J34947_10038032 | 3300002449 | Unclassified | 2498 |
| 7 | JGI24698J34947_10054017 | 3300002449 | Unclassified | 2008 |
| 8 | JGI24698J34947_10096052 | 3300002449 | Bacteria | 1345 |
| 9 | JGI24695J34938_10006643 | 3300002450 | Bacteria | 6900 |
| 10 | JGI24695J34938_10006745 | 3300002450 | Bacteria | 6832 |
| 11 | JGI24695J34938_10011898 | 3300002450 | Bacteria | 4650 |
| 12 | JGI24695J34938_10021432 | 3300002450 | Bacteria | 3161 |
| 13 | JGI24695J34938_10037784 | 3300002450 | Bacteria | 2191 |
| 14 | Ga0072941_1034012 | 3300005201 | Bacteria | 8546 |
| 15 | Ga0074263_115126 | 3300005485 | Bacteria | 1411 |
| 16 | Ga0222431_1000017 | 3300021190 | Bacteria | 1736 |
| 17 | Ga0255786_1003452 | 3300022815 | Bacteria | 1290 |
| 18 | Ga0466694_100480 | 3300042594 | Bacteria | 2483 |
| 19 | Ga0466699_136625 | 3300042597 | Bacteria | 7726 |
| 20 | Ga0466699_440015 | 3300042597 | Bacteria | 32912 |
| 21 | Ga0123356_11111717 | 3300010049 | Bacteria | 958 |
| 22 | Ga0123356_11997301 | 3300010049 | Bacteria | 723 |
| 23 | Ga0123353_10569346 | 3300010167 | Bacteria | 1629 |
| 24 | Ga0123354_10826016 | 3300010882 | Bacteria | 620 |
| 25 | Ga0466702_109144 | 3300042635 | Bacteria | 2300 |
| 26 | Ga0466727_053415 | 3300042655 | Bacteria | 5550 |
| 27 | Ga0466712_320433 | 3300042614 | Bacteria | 1017 |
| 28 | Ga0466720_042945 | 3300042607 | Bacteria | 11120 |
| 29 | Ga0466720_045553 | 3300042607 | Unclassified | 1078 |
| 30 | Ga0466720_095945 | 3300042607 | Bacteria | 2596 |
| 31 | Ga0466722_202911 | 3300042609 | Bacteria | 11614 |
| 32 | AustNasuHG_c1022854 | 3300000089 | Unclassified | 2003 |
| 33 | AustNasuHG_c1052144 | 3300000089 | Bacteria | 863 |
| 34 | FAAS_10300294 | 3300001880 | Unclassified | 563 |
| 35 | JGI24698J34947_10001062 | 3300002449 | Bacteria | 14136 |
| 36 | JGI24698J34947_10014607 | 3300002449 | Unclassified | 4277 |
| 37 | JGI24695J34938_10000450 | 3300002450 | Bacteria | 39866 |
| 38 | JGI24695J34938_10004601 | 3300002450 | Bacteria | 8974 |
| 39 | JGI24695J34938_10022751 | 3300002450 | Bacteria | 3035 |
| 40 | JGI24695J34938_10060154 | 3300002450 | Bacteria | 1622 |
| 41 | Ga0072940_1005237 | 3300005200 | Unclassified | 1073 |
| 42 | Ga0072941_1007590 | 3300005201 | Bacteria | 14830 |
| 43 | Ga0255808_1010607 | 3300023282 | Bacteria | 776 |
| 44 | Ga0466699_140591 | 3300042597 | Bacteria | 1387 |
| 45 | Ga0466699_150332 | 3300042597 | Bacteria | 9436 |
| 46 | Ga0466699_232363 | 3300042597 | Bacteria | 3933 |
| 47 | Ga0123356_10017861 | 3300010049 | Bacteria | 6738 |
| 48 | Ga0123356_10048438 | 3300010049 | Bacteria | 3955 |
| 49 | Ga0123356_10080131 | 3300010049 | Bacteria | 3086 |
| 50 | Ga0123353_13082093 | 3300010167 | Bacteria | 537 |
| 51 | Ga0466702_149045 | 3300042635 | Bacteria | 2155 |
| 52 | Ga0466702_259957 | 3300042635 | Bacteria | 1135 |
| 53 | Ga0466712_122719 | 3300042614 | Bacteria | 1195 |
| 54 | Ga0466700_036680 | 3300042600 | Bacteria | 2160 |
| 55 | Ga0466720_011964 | 3300042607 | Bacteria | 11141 |
| 56 | Ga0466720_013055 | 3300042607 | Bacteria | 1184 |
| 57 | Ga0466720_013370 | 3300042607 | Bacteria | 1238 |
| 58 | Ga0466720_054200 | 3300042607 | Bacteria | 3127 |
| 59 | Ga0466705_049931 | 3300042612 | Bacteria | 17901 |
| 60 | FAAS_10773553 | 3300001880 | Bacteria | 534 |
| 61 | JGI24698J34947_10334038 | 3300002449 | Bacteria | 535 |
| 62 | JGI24695J34938_10019394 | 3300002450 | Bacteria | 3371 |
| 63 | Ga0072941_1010167 | 3300005201 | Bacteria | 20585 |
| 64 | Ga0264413_108521 | 3300024493 | Bacteria | 12180 |
| 65 | Ga0264413_125284 | 3300024493 | Unclassified | 8047 |
| 66 | Ga0466657_323620 | 3300042582 | Bacteria | 1005 |
| 67 | Ga0466692_142411 | 3300042591 | Bacteria | 13707 |
| 68 | Ga0466693_121674 | 3300042592 | Bacteria | 3418 |
| 69 | Ga0466693_350261 | 3300042592 | Bacteria | 1094 |
| 70 | Ga0466694_036323 | 3300042594 | Bacteria | 4932 |
| 71 | Ga0466699_053531 | 3300042597 | Unclassified | 1845 |
| 72 | Ga0466699_134662 | 3300042597 | Bacteria | 7108 |
| 73 | Ga0466699_427968 | 3300042597 | Bacteria | 5289 |
| 74 | Ga0123356_11294818 | 3300010049 | Bacteria | 892 |
| 75 | Ga0123353_10185541 | 3300010167 | Bacteria | 3289 |
| 76 | Ga0466731_023663 | 3300042622 | Bacteria | 1679 |
| 77 | Ga0466702_181458 | 3300042635 | Bacteria | 2440 |
| 78 | Ga0466712_103338 | 3300042614 | Bacteria | 1563 |
| 79 | Ga0466712_265921 | 3300042614 | Bacteria | 33911 |
| 80 | Ga0466718_064859 | 3300042617 | Bacteria | 21008 |
| 81 | Ga0466700_080759 | 3300042600 | Bacteria | 2060 |
| 82 | Ga0466700_094842 | 3300042600 | Bacteria | 1005 |
| 83 | Ga0466720_042088 | 3300042607 | Bacteria | 4122 |
| 84 | Ga0466720_054987 | 3300042607 | Unclassified | 3163 |
| 85 | Ga0466720_076481 | 3300042607 | Bacteria | 15282 |
| 86 | Ga0466722_052189 | 3300042609 | Bacteria | 29475 |
| 87 | Ga0466698_425176 | 3300042610 | Bacteria | 4749 |
| 88 | Ga0466732_132816 | 3300042656 | Bacteria | 6454 |
| 89 | AustNasuHG_c1008962 | 3300000089 | Bacteria | 3535 |
| 90 | JGI24698J34947_10024612 | 3300002449 | Unclassified | 3214 |
| 91 | JGI24698J34947_10040095 | 3300002449 | Bacteria | 2420 |
| 92 | JGI24698J34947_10079004 | 3300002449 | Unclassified | 1550 |
| 93 | JGI24695J34938_10006860 | 3300002450 | Unclassified | 6760 |
| 94 | JGI24695J34938_10014678 | 3300002450 | Bacteria | 4049 |
| 95 | JGI24695J34938_10032536 | 3300002450 | Bacteria | 2408 |
| 96 | Ga0233288_1060249 | 3300022232 | Bacteria | 749 |
| 97 | Ga0466690_098327 | 3300042590 | Bacteria | 13880 |
| 98 | Ga0466692_126656 | 3300042591 | Bacteria | 7955 |
| 99 | Ga0466691_001852 | 3300042593 | Bacteria | 4316 |
| 100 | Ga0466699_280755 | 3300042597 | Bacteria | 1441 |
| 101 | Ga0123356_10000993 | 3300010049 | Bacteria | 31501 |
| 102 | Ga0123356_10187829 | 3300010049 | Bacteria | 2094 |
| 103 | Ga0123356_13969168 | 3300010049 | Bacteria | 510 |
| 104 | Ga0123353_10435442 | 3300010167 | Bacteria | 1937 |
| 105 | Ga0123353_11955109 | 3300010167 | Bacteria | 721 |
| 106 | Ga0123354_10183295 | 3300010882 | Bacteria | 2379 |
| 107 | Ga0466702_463340 | 3300042635 | Bacteria | 1372 |
| 108 | Ga0466712_041366 | 3300042614 | Bacteria | 20914 |
| 109 | Ga0466712_075745 | 3300042614 | Bacteria | 8656 |
| 110 | Ga0466712_118207 | 3300042614 | Unclassified | 9550 |
| 111 | Ga0466718_019694 | 3300042617 | Bacteria | 3972 |
| 112 | Ga0466718_083233 | 3300042617 | Bacteria | 1353 |
| 113 | Ga0466706_021761 | 3300042599 | Bacteria | 4125 |
| 114 | Ga0466706_186371 | 3300042599 | Bacteria | 1357 |
| 115 | Ga0466720_056365 | 3300042607 | Bacteria | 2945 |
| 116 | Ga0466722_189659 | 3300042609 | Bacteria | 4545 |
| 117 | Ga0466732_032055 | 3300042656 | Unclassified | 13127 |
| 118 | FAAS_10001451 | 3300001880 | Bacteria | 2106 |
| 119 | JGI24695J34938_10012500 | 3300002450 | Bacteria | 4495 |
| 120 | JGI24695J34938_10026963 | 3300002450 | Unclassified | 2722 |
| 121 | Ga0074263_120049 | 3300005485 | Unclassified | 833 |
| 122 | Ga0223688_1008604 | 3300021227 | Bacteria | 717 |
| 123 | Ga0223675_1014621 | 3300021237 | Bacteria | 552 |
| 124 | Ga0223675_1030923 | 3300021237 | Unclassified | 834 |
| 125 | Ga0233288_1005861 | 3300022232 | Bacteria | 858 |
| 126 | Ga0466693_060828 | 3300042592 | Bacteria | 9684 |
| 127 | Ga0466699_020594 | 3300042597 | Unclassified | 6074 |
| 128 | Ga0466699_098141 | 3300042597 | Bacteria | 1520 |
| 129 | Ga0466699_181281 | 3300042597 | Bacteria | 1350 |
| 130 | Ga0123356_10100072 | 3300010049 | Unclassified | 2780 |
| 131 | Ga0123356_10263808 | 3300010049 | Bacteria | 1808 |
| 132 | Ga0466712_002687 | 3300042614 | Unclassified | 6623 |
| 133 | Ga0466712_021690 | 3300042614 | Bacteria | 45968 |
| 134 | Ga0466712_072677 | 3300042614 | Bacteria | 1208 |
| 135 | Ga0466718_003625 | 3300042617 | Bacteria | 4827 |
| 136 | Ga0466718_165178 | 3300042617 | Bacteria | 17037 |
| 137 | Ga0466700_261924 | 3300042600 | Bacteria | 1070 |
| 138 | Ga0466717_113738 | 3300042604 | Bacteria | 1872 |
| 139 | Ga0466720_036094 | 3300042607 | Bacteria | 15608 |
| 140 | Ga0466720_177676 | 3300042607 | Bacteria | 91443 |
| 141 | Ga0466721_281601 | 3300042608 | Bacteria | 1507 |
| 142 | Ga0466698_330751 | 3300042610 | Bacteria | 1152 |
| 143 | Ga0466732_003143 | 3300042656 | Unclassified | 10661 |
| 144 | Ga0466732_098682 | 3300042656 | Bacteria | 5104 |
| 145 | AustNasuHG_c1031337 | 3300000089 | Bacteria | 1505 |
| 146 | JGI24698J34947_10001789 | 3300002449 | Bacteria | 11464 |
| 147 | JGI24698J34947_10004560 | 3300002449 | Unclassified | 7549 |
| 148 | JGI24698J34947_10011717 | 3300002449 | Bacteria | 4815 |
| 149 | JGI24698J34947_10014163 | 3300002449 | Bacteria | 4342 |
| 150 | JGI24698J34947_10037534 | 3300002449 | Bacteria | 2516 |
| 151 | JGI24695J34938_10011742 | 3300002450 | Bacteria | 4699 |
| 152 | JGI24695J34938_10018138 | 3300002450 | Bacteria | 3527 |
| 153 | Ga0072941_1015841 | 3300005201 | Bacteria | 14795 |
| 154 | Ga0074263_114504 | 3300005485 | Unclassified | 1248 |
| 155 | Ga0223686_1002848 | 3300021244 | Bacteria | 1184 |
| 156 | Ga0223683_1011721 | 3300021245 | Bacteria | 1381 |
| 157 | Ga0255786_1009814 | 3300022815 | Bacteria | 658 |
| 158 | Ga0255808_1008675 | 3300023282 | Bacteria | 1287 |
| 159 | Ga0264413_104402 | 3300024493 | Unclassified | 1232 |
| 160 | Ga0264413_106481 | 3300024493 | Unclassified | 3984 |
| 161 | Ga0264413_116006 | 3300024493 | Unclassified | 17792 |
| 162 | Ga0466699_436862 | 3300042597 | Bacteria | 1072 |
| 163 | Ga0123356_10080227 | 3300010049 | Bacteria | 3085 |
| 164 | Ga0123356_12565537 | 3300010049 | Bacteria | 638 |
| 165 | Ga0123353_10632528 | 3300010167 | Bacteria | 1520 |
| 166 | Ga0123353_12257120 | 3300010167 | Bacteria | 656 |
| 167 | Ga0466731_068971 | 3300042622 | Bacteria | 1645 |
| 168 | Ga0466702_237024 | 3300042635 | Bacteria | 1803 |
| 169 | Ga0466725_045111 | 3300042654 | Bacteria | 1530 |
| 170 | Ga0466718_014864 | 3300042617 | Bacteria | 2192 |
| 171 | Ga0466718_033043 | 3300042617 | Bacteria | 45100 |
| 172 | Ga0466718_168721 | 3300042617 | Bacteria | 11002 |
| 173 | Ga0466723_110631 | 3300042618 | Bacteria | 16832 |
| 174 | Ga0466706_183327 | 3300042599 | Bacteria | 1566 |
| 175 | Ga0466720_013474 | 3300042607 | Bacteria | 22051 |
| 176 | Ga0466720_069570 | 3300042607 | Bacteria | 8401 |
| 177 | Ga0466720_079683 | 3300042607 | Bacteria | 44811 |
| 178 | Ga0466722_240151 | 3300042609 | Unclassified | 6131 |
| 179 | Ga0466732_017858 | 3300042656 | Unclassified | 1358 |
| 180 | Ga0466732_208329 | 3300042656 | Unclassified | 2479 |
| 181 | AustNasuHG_c1011355 | 3300000089 | Unclassified | 3087 |
| 182 | FAAS_10728421 | 3300001880 | Unclassified | 560 |
| 183 | JGI24698J34947_10000501 | 3300002449 | Bacteria | 18414 |
| 184 | JGI24698J34947_10022189 | 3300002449 | Bacteria | 3408 |
| 185 | JGI24698J34947_10100347 | 3300002449 | Unclassified | 1303 |
| 186 | JGI24695J34938_10023366 | 3300002450 | Bacteria | 2982 |
| 187 | JGI24705J35276_12225469 | 3300002504 | Bacteria | 2725 |
| 188 | Ga0072941_1047834 | 3300005201 | Bacteria | 7067 |
| 189 | Ga0074263_136512 | 3300005485 | Unclassified | 895 |
| 190 | Ga0223674_1006084 | 3300021235 | Bacteria | 2053 |
| 191 | Ga0255786_1003451 | 3300022815 | Bacteria | 1225 |
| 192 | Ga0456237_0039974 | 3300041968 | Bacteria | 619 |
| 193 | Ga0466692_106330 | 3300042591 | Bacteria | 13288 |
| 194 | Ga0466693_261950 | 3300042592 | Bacteria | 1478 |
| 195 | Ga0466694_209082 | 3300042594 | Bacteria | 7012 |
| 196 | Ga0466699_187502 | 3300042597 | Bacteria | 9761 |
| 197 | Ga0466699_359498 | 3300042597 | Bacteria | 3203 |
| 198 | Ga0123355_10023557 | 3300009826 | Bacteria | 9888 |
| 199 | Ga0123356_10000482 | 3300010049 | Bacteria | 44631 |
| 200 | Ga0123356_11030871 | 3300010049 | Bacteria | 992 |
| 201 | Ga0466735_226872 | 3300042624 | Bacteria | 18732 |
| 202 | Ga0466702_061196 | 3300042635 | Bacteria | 3020 |
| 203 | Ga0466702_249706 | 3300042635 | Bacteria | 1078 |
| 204 | Ga0466702_317370 | 3300042635 | Bacteria | 1856 |
| 205 | Ga0466712_054741 | 3300042614 | Bacteria | 7824 |
| 206 | Ga0466712_123293 | 3300042614 | Unclassified | 1690 |
| 207 | Ga0466712_162820 | 3300042614 | Bacteria | 9684 |
| 208 | Ga0466718_026349 | 3300042617 | Bacteria | 1079 |
| 209 | Ga0466718_067828 | 3300042617 | Bacteria | 3973 |
| 210 | Ga0466718_096795 | 3300042617 | Bacteria | 5376 |
| 211 | Ga0466718_168376 | 3300042617 | Bacteria | 4320 |
| 212 | Ga0466726_152958 | 3300042619 | Bacteria | 4353 |
| 213 | Ga0466700_006598 | 3300042600 | Bacteria | 18116 |
| 214 | Ga0466720_103530 | 3300042607 | Bacteria | 1672 |
| 215 | Ga0466698_090495 | 3300042610 | Bacteria | 1464 |
| 216 | FAAS_10661556 | 3300001880 | Bacteria | 553 |
| 217 | JGI24698J34947_10081157 | 3300002449 | Unclassified | 1521 |
| 218 | JGI24698J34947_10200337 | 3300002449 | Bacteria | 782 |
| 219 | JGI24698J34947_10274621 | 3300002449 | Bacteria | 618 |
| 220 | JGI24695J34938_10000748 | 3300002450 | Bacteria | 30517 |
| 221 | JGI24695J34938_10007099 | 3300002450 | Bacteria | 6620 |
| 222 | JGI24695J34938_10010130 | 3300002450 | Bacteria | 5191 |
| 223 | JGI24695J34938_10031185 | 3300002450 | Bacteria | 2476 |
| 224 | JGI24695J34938_10302495 | 3300002450 | Bacteria | 691 |
| 225 | JGI24702J35022_10002824 | 3300002462 | Bacteria | 10527 |
| 226 | Ga0072941_1027572 | 3300005201 | Bacteria | 4262 |
| 227 | Ga0072941_1034010 | 3300005201 | Bacteria | 9006 |
| 228 | Ga0223674_1003974 | 3300021235 | Bacteria | 1079 |
| 229 | Ga0264413_110293 | 3300024493 | Bacteria | 13666 |
| 230 | Ga0466657_140411 | 3300042582 | Bacteria | 1124 |
| 231 | Ga0466692_002352 | 3300042591 | Bacteria | 7304 |
| 232 | Ga0466692_064375 | 3300042591 | Bacteria | 19414 |
| 233 | Ga0466699_152628 | 3300042597 | Bacteria | 3901 |
| 234 | Ga0466699_190731 | 3300042597 | Bacteria | 21954 |
| 235 | Ga0466699_243014 | 3300042597 | Bacteria | 4875 |
| 236 | Ga0466699_426379 | 3300042597 | Bacteria | 3592 |
| 237 | Ga0466699_426787 | 3300042597 | Unclassified | 2943 |
| 238 | Ga0123356_11148286 | 3300010049 | Bacteria | 944 |
| 239 | Ga0123356_11448948 | 3300010049 | Bacteria | 846 |
| 240 | Ga0123353_10254607 | 3300010167 | Bacteria | 2716 |
| 241 | Ga0123353_10845213 | 3300010167 | Bacteria | 1256 |
| 242 | Ga0466729_296295 | 3300042621 | Bacteria | 2114 |
| 243 | Ga0466702_156316 | 3300042635 | Unclassified | 1050 |
| 244 | Ga0466704_016527 | 3300042643 | Bacteria | 10202 |
| 245 | Ga0466711_306824 | 3300042615 | Bacteria | 5217 |
| 246 | Ga0466718_023537 | 3300042617 | Unclassified | 4442 |
| 247 | Ga0466718_046172 | 3300042617 | Unclassified | 1751 |
| 248 | Ga0466720_124588 | 3300042607 | Bacteria | 13568 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00453 | Ribosomal_L20 | Ribosomal protein L20 | 3 | 109 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.