Protein Family IF05372
Metagenome
Metatranscriptome
Isolate
138
Members
57
Samples
128
Scaffolds
78.39
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_402435|Ga0466699_402435_138_413
- Length
- 91 aa
- Sequence
- MLILSRKIDEKIMIGDNISVSVIEIRGDQVRIGVDAPKTVKVYRREVYDAILAENKAAAESKPVLPAVDFGGPQQQSAQLMTSNPVDKSKI
Sample Types
Isolate
7.2%
Metagenome
92.0%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.6%
Kalotermitidae
25.0%
Unclassified
19.6%
Rhinotermitidae
5.4%
Termopsidae
3.6%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 14 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 30 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 31 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 35 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 36 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 37 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 42 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 45 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 46 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 47 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 48 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_373454 | 3300042590 | Bacteria | 1394 |
| 2 | Ga0466692_013015 | 3300042591 | Bacteria | 22521 |
| 3 | Ga0466692_060419 | 3300042591 | Bacteria | 15758 |
| 4 | Ga0466691_073171 | 3300042593 | Unclassified | 2743 |
| 5 | Ga0466699_057782 | 3300042597 | Bacteria | 4143 |
| 6 | Ga0466699_344356 | 3300042597 | Bacteria | 1264 |
| 7 | Ga0466722_205111 | 3300042609 | Bacteria | 5549 |
| 8 | Ga0123357_10970907 | 3300009784 | Bacteria | 534 |
| 9 | Ga0466735_206373 | 3300042624 | Bacteria | 1247 |
| 10 | Ga0466723_207507 | 3300042618 | Bacteria | 5310 |
| 11 | Ga0466728_414432 | 3300042620 | Bacteria | 5411 |
| 12 | JGI24695J34938_10006193 | 3300002450 | Bacteria | 7268 |
| 13 | JGI24702J35022_10124900 | 3300002462 | Bacteria | 1424 |
| 14 | Ga0072940_1127224 | 3300005200 | Bacteria | 1136 |
| 15 | Ga0072941_1003454 | 3300005201 | Bacteria | 7153 |
| 16 | Ga0255786_1002184 | 3300022815 | Unclassified | 1222 |
| 17 | Ga0466690_302806 | 3300042590 | Bacteria | 1812 |
| 18 | Ga0466695_139683 | 3300042595 | Bacteria | 7187 |
| 19 | Ga0466707_253066 | 3300042601 | Bacteria | 1587 |
| 20 | Ga0123355_10175824 | 3300009826 | Bacteria | 3188 |
| 21 | Ga0123353_11075375 | 3300010167 | Bacteria | 1071 |
| 22 | Ga0123353_11205948 | 3300010167 | Bacteria | 993 |
| 23 | Ga0123353_12320602 | 3300010167 | Bacteria | 644 |
| 24 | Ga0466708_044472 | 3300042652 | Bacteria | 26279 |
| 25 | Ga0466723_046084 | 3300042618 | Bacteria | 2846 |
| 26 | JGI24698J34947_10017513 | 3300002449 | Unclassified | 3881 |
| 27 | JGI24702J35022_10752595 | 3300002462 | Bacteria | 606 |
| 28 | JGI24705J35276_12207011 | 3300002504 | Bacteria | 1734 |
| 29 | Ga0466705_343858 | 3300042612 | Bacteria | 7021 |
| 30 | Ga0466690_254487 | 3300042590 | Bacteria | 4824 |
| 31 | Ga0466692_077918 | 3300042591 | Bacteria | 6544 |
| 32 | Ga0466691_082912 | 3300042593 | Bacteria | 11098 |
| 33 | Ga0466699_432927 | 3300042597 | Bacteria | 2653 |
| 34 | Ga0466706_059039 | 3300042599 | Bacteria | 1329 |
| 35 | Ga0466716_293565 | 3300042605 | Bacteria | 4675 |
| 36 | Ga0466719_404816 | 3300042606 | Bacteria | 3479 |
| 37 | Ga0466722_082473 | 3300042609 | Bacteria | 31404 |
| 38 | Ga0123356_11174350 | 3300010049 | Bacteria | 934 |
| 39 | Ga0466708_076855 | 3300042652 | Bacteria | 5941 |
| 40 | Ga0466718_072178 | 3300042617 | Bacteria | 1039 |
| 41 | Ga0466723_347993 | 3300042618 | Bacteria | 25507 |
| 42 | JGI24698J34947_10026985 | 3300002449 | Bacteria | 3048 |
| 43 | JGI24697J35500_11205289 | 3300002507 | Unclassified | 1711 |
| 44 | Ga0466732_011951 | 3300042656 | Bacteria | 13739 |
| 45 | Ga0466690_086888 | 3300042590 | Bacteria | 9704 |
| 46 | Ga0466692_031113 | 3300042591 | Bacteria | 7938 |
| 47 | Ga0466716_461108 | 3300042605 | Bacteria | 1371 |
| 48 | Ga0466698_429934 | 3300042610 | Bacteria | 1030 |
| 49 | Ga0123356_12830623 | 3300010049 | Bacteria | 607 |
| 50 | Ga0123353_11887890 | 3300010167 | Bacteria | 738 |
| 51 | Ga0466702_187103 | 3300042635 | Bacteria | 1009 |
| 52 | Ga0466708_183683 | 3300042652 | Bacteria | 5093 |
| 53 | Ga0466712_128028 | 3300042614 | Bacteria | 17639 |
| 54 | Ga0466711_022289 | 3300042615 | Bacteria | 20333 |
| 55 | Ga0466726_454466 | 3300042619 | Bacteria | 1235 |
| 56 | Ga0466728_032701 | 3300042620 | Bacteria | 12669 |
| 57 | JGI24698J34947_10069069 | 3300002449 | Bacteria | 1706 |
| 58 | Ga0072940_1105793 | 3300005200 | Bacteria | 2399 |
| 59 | Ga0072941_1003453 | 3300005201 | Bacteria | 10168 |
| 60 | Ga0466694_045169 | 3300042594 | Bacteria | 2741 |
| 61 | Ga0466694_070159 | 3300042594 | Bacteria | 2159 |
| 62 | Ga0466696_404855 | 3300042596 | Bacteria | 6845 |
| 63 | Ga0466699_402435 | 3300042597 | Bacteria | 1905 |
| 64 | Ga0466719_564357 | 3300042606 | Bacteria | 19436 |
| 65 | Ga0123356_12003140 | 3300010049 | Bacteria | 722 |
| 66 | Ga0123356_13554857 | 3300010049 | Bacteria | 540 |
| 67 | Ga0123353_11874715 | 3300010167 | Bacteria | 741 |
| 68 | Ga0466703_286947 | 3300042636 | Bacteria | 1527 |
| 69 | Ga0466704_174279 | 3300042643 | Bacteria | 23732 |
| 70 | Ga0466704_561052 | 3300042643 | Bacteria | 2688 |
| 71 | Ga0466726_382045 | 3300042619 | Bacteria | 3614 |
| 72 | AustNasuHG_c1000682 | 3300000089 | Bacteria | 12071 |
| 73 | JGI24705J35276_11418814 | 3300002504 | Bacteria | 532 |
| 74 | Ga0415639_023874 | 3300038395 | Bacteria | 2383 |
| 75 | Ga0466694_161348 | 3300042594 | Bacteria | 1132 |
| 76 | Ga0466719_164021 | 3300042606 | Bacteria | 3343 |
| 77 | Ga0466722_123596 | 3300042609 | Bacteria | 3220 |
| 78 | Ga0466722_176295 | 3300042609 | Bacteria | 1661 |
| 79 | Ga0123357_10075728 | 3300009784 | Bacteria | 4447 |
| 80 | Ga0123357_10167517 | 3300009784 | Bacteria | 2611 |
| 81 | Ga0123357_10613547 | 3300009784 | Bacteria | 827 |
| 82 | Ga0123354_10760316 | 3300010882 | Bacteria | 662 |
| 83 | Ga0466735_157415 | 3300042624 | Bacteria | 1234 |
| 84 | Ga0466703_012817 | 3300042636 | Bacteria | 5494 |
| 85 | Ga0466709_350218 | 3300042648 | Bacteria | 8916 |
| 86 | Ga0466712_226326 | 3300042614 | Bacteria | 1666 |
| 87 | Ga0466711_281397 | 3300042615 | Bacteria | 4055 |
| 88 | Ga0466718_097746 | 3300042617 | Bacteria | 1052 |
| 89 | Ga0466723_120135 | 3300042618 | Bacteria | 3350 |
| 90 | Ga0466728_476387 | 3300042620 | Bacteria | 4961 |
| 91 | Ga0466691_092773 | 3300042593 | Bacteria | 19552 |
| 92 | Ga0466720_123457 | 3300042607 | Bacteria | 1287 |
| 93 | Ga0466698_252791 | 3300042610 | Bacteria | 1244 |
| 94 | Ga0123356_12929709 | 3300010049 | Bacteria | 596 |
| 95 | Ga0123353_10549719 | 3300010167 | Bacteria | 1666 |
| 96 | Ga0123353_12516517 | 3300010167 | Bacteria | 612 |
| 97 | Ga0123354_10138275 | 3300010882 | Bacteria | 3031 |
| 98 | Ga0466735_007718 | 3300042624 | Bacteria | 1024 |
| 99 | Ga0466703_274089 | 3300042636 | Bacteria | 1830 |
| 100 | Ga0466704_036076 | 3300042643 | Bacteria | 2623 |
| 101 | Ga0466712_185026 | 3300042614 | Bacteria | 3456 |
| 102 | Ga0466723_083074 | 3300042618 | Bacteria | 10782 |
| 103 | AustNasuHG_c1002479 | 3300000089 | Bacteria | 6681 |
| 104 | AustNasuHG_c1006176 | 3300000089 | Bacteria | 4281 |
| 105 | JGI24702J35022_10020792 | 3300002462 | Bacteria | 3560 |
| 106 | Ga0074263_104835 | 3300005485 | Bacteria | 1435 |
| 107 | Ga0466705_080433 | 3300042612 | Bacteria | 3319 |
| 108 | Ga0466732_249875 | 3300042656 | Bacteria | 5179 |
| 109 | Ga0456237_0027672 | 3300041968 | Bacteria | 767 |
| 110 | Ga0456237_0042238 | 3300041968 | Bacteria | 601 |
| 111 | Ga0466693_172378 | 3300042592 | Bacteria | 4870 |
| 112 | Ga0466696_422507 | 3300042596 | Bacteria | 2111 |
| 113 | Ga0466699_308724 | 3300042597 | Bacteria | 1827 |
| 114 | Ga0466707_056938 | 3300042601 | Bacteria | 3811 |
| 115 | Ga0123355_10264781 | 3300009826 | Bacteria | 2398 |
| 116 | Ga0123353_10040493 | 3300010167 | Bacteria | 7352 |
| 117 | Ga0466704_207868 | 3300042643 | Bacteria | 15581 |
| 118 | Ga0466708_226192 | 3300042652 | Bacteria | 21675 |
| 119 | Ga0466708_355996 | 3300042652 | Bacteria | 1164 |
| 120 | Ga0466712_078633 | 3300042614 | Unclassified | 4584 |
| 121 | Ga0466715_485714 | 3300042616 | Bacteria | 27285 |
| 122 | Ga0466718_047698 | 3300042617 | Bacteria | 18884 |
| 123 | Ga0466723_348609 | 3300042618 | Bacteria | 1909 |
| 124 | JGI24698J34947_10006948 | 3300002449 | Bacteria | 6223 |
| 125 | JGI24698J34947_10161168 | 3300002449 | Bacteria | 919 |
| 126 | JGI24702J35022_10002060 | 3300002462 | Unclassified | 12402 |
| 127 | JGI24705J35276_12229625 | 3300002504 | Bacteria | 3427 |
| 128 | Ga0072940_1261790 | 3300005200 | Bacteria | 1035 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02599 | CsrA | Global regulator protein family | 1 | 51 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.