Protein Family IF05169
Metagenome
Isolate
343
Members
103
Samples
299
Scaffolds
126.3
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_181092|Ga0466696_181092_8667_9122
- Length
- 151 aa
- Sequence
- MCIFANPKKQDIFLSLNLRKGEKTMAEEKTRYSDAELEEFRQLINEKLEKAQKEYELLRNSLNNLDGNDVADTSPTFKVLEEGAATLSKEEAGRLAQRQMKFIQHLQAALIRIENKTYGVCRETGKLIPKERLRAVPHATLSIEAKQGENK
Sample Types
Isolate
12.8%
Metagenome
87.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
29.7%
Termitidae
28.7%
Kalotermitidae
13.9%
Unclassified
12.9%
Rhinotermitidae
5.0%
Termopsidae
3.0%
Passalidae
3.0%
Hydrophilidae
2.0%
Tenebrionidae
1.0%
Hodotermitidae
1.0%
Taxonomy
Archaea
1
Bacteria
281
Eukaryota
0
Viruses
0
Unclassified
61
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 2 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 3 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 4 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 5 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 6 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 7 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 8 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 9 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 10 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 11 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 12 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 13 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 14 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 15 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 24 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 30 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 31 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 32 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 33 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 40 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 41 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 42 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 43 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 44 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 45 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 46 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 50 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 51 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 52 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 53 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 54 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 55 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 56 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 57 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 58 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 59 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 60 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 61 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 62 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 63 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 64 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 65 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 66 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 67 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 68 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 69 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 70 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 71 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 72 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 73 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 74 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 75 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 76 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 77 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 78 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 79 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 80 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 81 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 82 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 83 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 84 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 85 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 86 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 87 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 88 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 89 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 90 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 91 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 92 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 93 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 94 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 95 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 96 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 97 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 98 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 99 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 100 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 101 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 102 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 103 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_048665 | 3300042659 | Bacteria | 27056 |
| 2 | Ga0466733_199358 | 3300042659 | Bacteria | 2858 |
| 3 | Ga0466733_216132 | 3300042659 | Bacteria | 221678 |
| 4 | Ga0466703_089257 | 3300042636 | Bacteria | 16208 |
| 5 | Ga0466703_155535 | 3300042636 | Bacteria | 15135 |
| 6 | Ga0466704_087721 | 3300042643 | Unclassified | 8602 |
| 7 | Ga0466704_170080 | 3300042643 | Bacteria | 45113 |
| 8 | Ga0466704_229321 | 3300042643 | Bacteria | 1386 |
| 9 | Ga0466704_518766 | 3300042643 | Unclassified | 5354 |
| 10 | Ga0466706_269851 | 3300042599 | Bacteria | 36528 |
| 11 | Ga0466707_040980 | 3300042601 | Bacteria | 10065 |
| 12 | Ga0466707_193740 | 3300042601 | Bacteria | 6133 |
| 13 | Ga0466707_350599 | 3300042601 | Bacteria | 3854 |
| 14 | Ga0466713_030499 | 3300042602 | Unclassified | 2962 |
| 15 | Ga0466714_039160 | 3300042603 | Bacteria | 1316 |
| 16 | Ga0466714_058251 | 3300042603 | Unclassified | 1174 |
| 17 | Ga0466714_059327 | 3300042603 | Bacteria | 1196 |
| 18 | Ga0466714_112290 | 3300042603 | Unclassified | 6276 |
| 19 | Ga0466716_031926 | 3300042605 | Bacteria | 8747 |
| 20 | Ga0265387_1006984 | 3300024582 | Bacteria | 1513 |
| 21 | Ga0466690_046892 | 3300042590 | Bacteria | 11669 |
| 22 | Ga0466693_175109 | 3300042592 | Unclassified | 1271 |
| 23 | Ga0466693_184661 | 3300042592 | Unclassified | 4045 |
| 24 | Ga0466694_223311 | 3300042594 | Unclassified | 1718 |
| 25 | Ga0466695_141098 | 3300042595 | Unclassified | 2686 |
| 26 | Ga0466696_085675 | 3300042596 | Bacteria | 7447 |
| 27 | Ga0123357_10178251 | 3300009784 | Bacteria | 2491 |
| 28 | Ga0466711_322035 | 3300042615 | Bacteria | 3591 |
| 29 | Ga0466715_590942 | 3300042616 | Bacteria | 23118 |
| 30 | Ga0466723_241952 | 3300042618 | Bacteria | 23081 |
| 31 | Ga0466723_346776 | 3300042618 | Bacteria | 18060 |
| 32 | Ga0466697_249970 | 3300042611 | Bacteria | 1738 |
| 33 | Ga0466733_095979 | 3300042659 | Unclassified | 4011 |
| 34 | Ga0466733_165612 | 3300042659 | Bacteria | 11642 |
| 35 | Ga0466733_202351 | 3300042659 | Bacteria | 83787 |
| 36 | Ga0466733_220487 | 3300042659 | Bacteria | 12383 |
| 37 | Ga0466704_000365 | 3300042643 | Bacteria | 8573 |
| 38 | Ga0466704_035997 | 3300042643 | Bacteria | 13784 |
| 39 | Ga0466704_081344 | 3300042643 | Bacteria | 118045 |
| 40 | Ga0466704_113028 | 3300042643 | Unclassified | 5355 |
| 41 | Ga0466708_215813 | 3300042652 | Unclassified | 25331 |
| 42 | Ga0466701_073917 | 3300042598 | Bacteria | 1485 |
| 43 | Ga0466706_064231 | 3300042599 | Bacteria | 49852 |
| 44 | Ga0466706_106204 | 3300042599 | Bacteria | 73373 |
| 45 | Ga0466706_117226 | 3300042599 | Bacteria | 1443 |
| 46 | Ga0466707_080227 | 3300042601 | Bacteria | 11157 |
| 47 | Ga0466713_125008 | 3300042602 | Bacteria | 12791 |
| 48 | Ga0466714_063127 | 3300042603 | Unclassified | 1035 |
| 49 | Ga0466714_125797 | 3300042603 | Bacteria | 2517 |
| 50 | Ga0466714_160702 | 3300042603 | Bacteria | 4731 |
| 51 | 2227393590 | 2225789004 | Bacteria | 1083 |
| 52 | 2227528259 | 2225789004 | Bacteria | 3201 |
| 53 | IMNBL1DRAFT_c0096140 | 3300000062 | Bacteria | 804 |
| 54 | Ga0068305_10043648 | 3300005083 | Bacteria | 2219 |
| 55 | Ga0068305_10585927 | 3300005083 | Unclassified | 2569 |
| 56 | Ga0265387_1057240 | 3300024582 | Bacteria | 717 |
| 57 | Ga0466691_150341 | 3300042593 | Bacteria | 5322 |
| 58 | Ga0466696_321323 | 3300042596 | Bacteria | 21750 |
| 59 | Ga0466696_340642 | 3300042596 | Bacteria | 2114 |
| 60 | Ga0123355_10000975 | 3300009826 | Bacteria | 39660 |
| 61 | Ga0123356_13023435 | 3300010049 | Unclassified | 587 |
| 62 | Ga0123356_13304999 | 3300010049 | Unclassified | 561 |
| 63 | Ga0123353_10814324 | 3300010167 | Bacteria | 1287 |
| 64 | Ga0123354_10389248 | 3300010882 | Bacteria | 1194 |
| 65 | Ga0123354_10979633 | 3300010882 | Bacteria | 546 |
| 66 | Ga0466711_256158 | 3300042615 | Bacteria | 17199 |
| 67 | Ga0466711_334252 | 3300042615 | Bacteria | 7898 |
| 68 | Ga0466715_175149 | 3300042616 | Bacteria | 15834 |
| 69 | Ga0466728_476474 | 3300042620 | Bacteria | 34596 |
| 70 | Ga0466697_210968 | 3300042611 | Bacteria | 1400 |
| 71 | Ga0466705_005728 | 3300042612 | Unclassified | 3504 |
| 72 | Ga0466732_330297 | 3300042656 | Bacteria | 1301 |
| 73 | Ga0466733_027960 | 3300042659 | Bacteria | 1867 |
| 74 | Ga0466733_160784 | 3300042659 | Bacteria | 34990 |
| 75 | Ga0466731_219517 | 3300042622 | Unclassified | 5589 |
| 76 | Ga0466730_051911 | 3300042625 | Unclassified | 2126 |
| 77 | Ga0466703_104093 | 3300042636 | Bacteria | 31910 |
| 78 | Ga0466704_315261 | 3300042643 | Bacteria | 28450 |
| 79 | Ga0466709_067819 | 3300042648 | Bacteria | 16344 |
| 80 | Ga0466709_327430 | 3300042648 | Bacteria | 7564 |
| 81 | Ga0466724_47710 | 3300042649 | Bacteria | 1742 |
| 82 | Ga0466725_185875 | 3300042654 | Unclassified | 1486 |
| 83 | Ga0466727_025733 | 3300042655 | Bacteria | 15746 |
| 84 | Ga0466706_006525 | 3300042599 | Bacteria | 36305 |
| 85 | Ga0466706_104274 | 3300042599 | Bacteria | 20552 |
| 86 | Ga0466706_184148 | 3300042599 | Unclassified | 5988 |
| 87 | Ga0466700_213095 | 3300042600 | Bacteria | 3170 |
| 88 | Ga0466713_054355 | 3300042602 | Bacteria | 3586 |
| 89 | Ga0466713_054373 | 3300042602 | Unclassified | 7576 |
| 90 | Ga0466713_112916 | 3300042602 | Bacteria | 35573 |
| 91 | Ga0466714_075077 | 3300042603 | Bacteria | 4267 |
| 92 | Ga0466714_123800 | 3300042603 | Unclassified | 1130 |
| 93 | Ga0466722_104828 | 3300042609 | Bacteria | 47798 |
| 94 | Ga0466722_235976 | 3300042609 | Bacteria | 1036 |
| 95 | IMNBL1DRAFT_c0014505 | 3300000062 | Bacteria | 3473 |
| 96 | IMNBL1DRAFT_c0039532 | 3300000062 | Bacteria | 1608 |
| 97 | IMNBL1DRAFT_c0052059 | 3300000062 | Bacteria | 1285 |
| 98 | JGI24702J35022_10060864 | 3300002462 | Bacteria | 2019 |
| 99 | Ga0466656_159483 | 3300042550 | Unclassified | 11762 |
| 100 | Ga0466690_293612 | 3300042590 | Bacteria | 14441 |
| 101 | Ga0466692_151819 | 3300042591 | Bacteria | 23747 |
| 102 | Ga0466696_387788 | 3300042596 | Bacteria | 10391 |
| 103 | Ga0466696_462750 | 3300042596 | Bacteria | 2014 |
| 104 | Ga0123357_10230660 | 3300009784 | Bacteria | 2030 |
| 105 | Ga0123353_10083783 | 3300010167 | Bacteria | 5132 |
| 106 | Ga0123353_10090256 | 3300010167 | Bacteria | 4934 |
| 107 | Ga0466705_478405 | 3300042612 | Unclassified | 2971 |
| 108 | Ga0466711_229722 | 3300042615 | Bacteria | 14077 |
| 109 | Ga0466715_312116 | 3300042616 | Bacteria | 38473 |
| 110 | Ga0466723_303831 | 3300042618 | Bacteria | 6733 |
| 111 | Ga0466726_344695 | 3300042619 | Archaea | 2847 |
| 112 | Ga0466728_346254 | 3300042620 | Bacteria | 9752 |
| 113 | Ga0466705_072386 | 3300042612 | Unclassified | 3038 |
| 114 | Ga0466705_250608 | 3300042612 | Bacteria | 23162 |
| 115 | Ga0466733_078029 | 3300042659 | Unclassified | 9440 |
| 116 | Ga0466733_136400 | 3300042659 | Bacteria | 4898 |
| 117 | Ga0466733_146802 | 3300042659 | Unclassified | 1372 |
| 118 | Ga0466735_033174 | 3300042624 | Bacteria | 2848 |
| 119 | Ga0466704_223016 | 3300042643 | Bacteria | 8406 |
| 120 | Ga0466709_039815 | 3300042648 | Bacteria | 3868 |
| 121 | Ga0466708_115043 | 3300042652 | Bacteria | 12093 |
| 122 | Ga0466706_251964 | 3300042599 | Bacteria | 2298 |
| 123 | Ga0466706_284865 | 3300042599 | Unclassified | 3229 |
| 124 | Ga0466713_010036 | 3300042602 | Bacteria | 14379 |
| 125 | Ga0466713_063067 | 3300042602 | Bacteria | 116971 |
| 126 | Ga0466713_098989 | 3300042602 | Bacteria | 18122 |
| 127 | Ga0466714_014859 | 3300042603 | Unclassified | 2138 |
| 128 | Ga0466714_058846 | 3300042603 | Bacteria | 8084 |
| 129 | Ga0466714_090690 | 3300042603 | Bacteria | 1026 |
| 130 | Ga0466714_106262 | 3300042603 | Bacteria | 5677 |
| 131 | Ga0466714_120098 | 3300042603 | Unclassified | 1840 |
| 132 | Ga0466714_127289 | 3300042603 | Bacteria | 51946 |
| 133 | Ga0466714_169031 | 3300042603 | Bacteria | 152952 |
| 134 | Ga0466716_145341 | 3300042605 | Bacteria | 4659 |
| 135 | Ga0466719_414553 | 3300042606 | Bacteria | 6947 |
| 136 | Ga0466722_193568 | 3300042609 | Bacteria | 1896 |
| 137 | 2227569803 | 2225789004 | Bacteria | 539 |
| 138 | IMNBL1DRAFT_c0096589 | 3300000062 | Bacteria | 801 |
| 139 | JGI24698J34947_10161882 | 3300002449 | Unclassified | 915 |
| 140 | JGI24702J35022_10001619 | 3300002462 | Bacteria | 13929 |
| 141 | JGI24696J40584_12916085 | 3300002834 | Bacteria | 1300 |
| 142 | Ga0466656_149237 | 3300042550 | Bacteria | 1227 |
| 143 | Ga0466656_343640 | 3300042550 | Bacteria | 1050 |
| 144 | Ga0466690_070020 | 3300042590 | Bacteria | 35822 |
| 145 | Ga0466692_153720 | 3300042591 | Bacteria | 16364 |
| 146 | Ga0466696_413179 | 3300042596 | Bacteria | 2236 |
| 147 | Ga0123355_10177582 | 3300009826 | Bacteria | 3168 |
| 148 | Ga0466705_408219 | 3300042612 | Bacteria | 7814 |
| 149 | Ga0466710_067617 | 3300042613 | Bacteria | 2040 |
| 150 | Ga0466726_292091 | 3300042619 | Bacteria | 2392 |
| 151 | Ga0466733_013490 | 3300042659 | Bacteria | 7990 |
| 152 | Ga0466733_104987 | 3300042659 | Bacteria | 3351 |
| 153 | Ga0466733_138304 | 3300042659 | Bacteria | 6992 |
| 154 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 155 | Ga0466734_172830 | 3300042623 | Bacteria | 1301 |
| 156 | Ga0466735_047736 | 3300042624 | Bacteria | 4819 |
| 157 | Ga0466735_167086 | 3300042624 | Unclassified | 4543 |
| 158 | Ga0466703_225658 | 3300042636 | Bacteria | 15470 |
| 159 | Ga0466706_048935 | 3300042599 | Bacteria | 3784 |
| 160 | Ga0466707_345757 | 3300042601 | Unclassified | 1314 |
| 161 | Ga0466713_093219 | 3300042602 | Bacteria | 10700 |
| 162 | Ga0466714_160260 | 3300042603 | Unclassified | 4023 |
| 163 | Ga0466717_136168 | 3300042604 | Bacteria | 1340 |
| 164 | Ga0466716_064700 | 3300042605 | Bacteria | 1648 |
| 165 | Ga0466698_092878 | 3300042610 | Unclassified | 1218 |
| 166 | Ga0466698_127897 | 3300042610 | Unclassified | 2401 |
| 167 | IMNBL1DRAFT_c0001182 | 3300000062 | Bacteria | 19907 |
| 168 | IMNBL1DRAFT_c0022611 | 3300000062 | Bacteria | 2483 |
| 169 | IMNBL1DRAFT_c0040374 | 3300000062 | Bacteria | 1580 |
| 170 | Ga0068305_10011223 | 3300005083 | Bacteria | 23115 |
| 171 | Ga0068305_10043572 | 3300005083 | Unclassified | 6006 |
| 172 | Ga0466691_177481 | 3300042593 | Bacteria | 8324 |
| 173 | Ga0466694_052166 | 3300042594 | Unclassified | 1209 |
| 174 | Ga0466696_149521 | 3300042596 | Unclassified | 2315 |
| 175 | Ga0466696_181092 | 3300042596 | Bacteria | 12612 |
| 176 | Ga0466696_310053 | 3300042596 | Bacteria | 7506 |
| 177 | Ga0466705_481814 | 3300042612 | Bacteria | 1336 |
| 178 | Ga0466711_275188 | 3300042615 | Bacteria | 8434 |
| 179 | Ga0466723_206363 | 3300042618 | Bacteria | 15295 |
| 180 | Ga0466723_224491 | 3300042618 | Bacteria | 10542 |
| 181 | Ga0466728_304035 | 3300042620 | Unclassified | 2119 |
| 182 | Ga0466733_062410 | 3300042659 | Bacteria | 13175 |
| 183 | Ga0466733_062710 | 3300042659 | Bacteria | 13440 |
| 184 | Ga0466733_083631 | 3300042659 | Unclassified | 4720 |
| 185 | Ga0466733_167957 | 3300042659 | Bacteria | 1404 |
| 186 | Ga0466703_262233 | 3300042636 | Bacteria | 9120 |
| 187 | Ga0466703_393702 | 3300042636 | Bacteria | 10823 |
| 188 | Ga0466704_108246 | 3300042643 | Bacteria | 8570 |
| 189 | Ga0466704_221701 | 3300042643 | Bacteria | 3132 |
| 190 | Ga0466709_186426 | 3300042648 | Bacteria | 4067 |
| 191 | Ga0466708_064990 | 3300042652 | Bacteria | 13929 |
| 192 | Ga0466727_121775 | 3300042655 | Bacteria | 4232 |
| 193 | Ga0466707_157882 | 3300042601 | Bacteria | 6689 |
| 194 | Ga0466714_152890 | 3300042603 | Unclassified | 2120 |
| 195 | Ga0466716_040402 | 3300042605 | Bacteria | 10567 |
| 196 | Ga0466719_300366 | 3300042606 | Bacteria | 6122 |
| 197 | Ga0466698_503518 | 3300042610 | Bacteria | 1023 |
| 198 | 2227621863 | 2225789004 | Bacteria | 11672 |
| 199 | JGI24702J35022_10098423 | 3300002462 | Unclassified | 1599 |
| 200 | Ga0068305_10021708 | 3300005083 | Bacteria | 17784 |
| 201 | Ga0466690_070430 | 3300042590 | Bacteria | 26008 |
| 202 | Ga0466690_131176 | 3300042590 | Bacteria | 21782 |
| 203 | Ga0466690_238725 | 3300042590 | Bacteria | 2427 |
| 204 | Ga0466692_080751 | 3300042591 | Bacteria | 10821 |
| 205 | Ga0466695_226437 | 3300042595 | Unclassified | 1246 |
| 206 | Ga0466696_175286 | 3300042596 | Bacteria | 3496 |
| 207 | Ga0466696_278891 | 3300042596 | Bacteria | 171866 |
| 208 | Ga0123356_10084329 | 3300010049 | Bacteria | 3011 |
| 209 | Ga0123353_10224720 | 3300010167 | Unclassified | 2932 |
| 210 | Ga0123354_10240598 | 3300010882 | Bacteria | 1863 |
| 211 | Ga0466705_514300 | 3300042612 | Unclassified | 4483 |
| 212 | Ga0466710_170689 | 3300042613 | Bacteria | 1363 |
| 213 | Ga0466711_188466 | 3300042615 | Bacteria | 2349 |
| 214 | Ga0466728_390398 | 3300042620 | Bacteria | 71913 |
| 215 | Ga0466728_449254 | 3300042620 | Bacteria | 6801 |
| 216 | Ga0466733_039527 | 3300042659 | Unclassified | 7254 |
| 217 | Ga0466733_072479 | 3300042659 | Bacteria | 5918 |
| 218 | Ga0466703_195126 | 3300042636 | Unclassified | 1904 |
| 219 | Ga0466704_271613 | 3300042643 | Bacteria | 9548 |
| 220 | Ga0466704_537570 | 3300042643 | Bacteria | 25299 |
| 221 | Ga0466725_220873 | 3300042654 | Bacteria | 3475 |
| 222 | Ga0466727_181647 | 3300042655 | Bacteria | 3198 |
| 223 | Ga0466701_083705 | 3300042598 | Bacteria | 1562 |
| 224 | Ga0466701_101695 | 3300042598 | Bacteria | 6511 |
| 225 | Ga0466706_108112 | 3300042599 | Bacteria | 1198 |
| 226 | Ga0466713_090166 | 3300042602 | Unclassified | 1294 |
| 227 | Ga0466713_101917 | 3300042602 | Bacteria | 17048 |
| 228 | Ga0466714_127618 | 3300042603 | Bacteria | 4532 |
| 229 | Ga0466714_149627 | 3300042603 | Unclassified | 3581 |
| 230 | Ga0466716_173440 | 3300042605 | Bacteria | 11156 |
| 231 | Ga0466722_222048 | 3300042609 | Bacteria | 6355 |
| 232 | IMNBL1DRAFT_c0037188 | 3300000062 | Bacteria | 1690 |
| 233 | JGI24702J35022_10385296 | 3300002462 | Unclassified | 844 |
| 234 | JGI24702J35022_10505407 | 3300002462 | Unclassified | 741 |
| 235 | JGI24696J40584_12960849 | 3300002834 | Bacteria | 8893 |
| 236 | Ga0072940_1352345 | 3300005200 | Bacteria | 2039 |
| 237 | Ga0072941_1370776 | 3300005201 | Bacteria | 3482 |
| 238 | Ga0123357_10001480 | 3300009784 | Bacteria | 24959 |
| 239 | Ga0466657_290285 | 3300042582 | Bacteria | 14131 |
| 240 | Ga0466692_142212 | 3300042591 | Bacteria | 34601 |
| 241 | Ga0466694_066948 | 3300042594 | Bacteria | 1005 |
| 242 | Ga0123353_10089641 | 3300010167 | Bacteria | 4952 |
| 243 | Ga0466710_367090 | 3300042613 | Bacteria | 2415 |
| 244 | Ga0466711_063885 | 3300042615 | Bacteria | 12878 |
| 245 | Ga0466711_324388 | 3300042615 | Bacteria | 21299 |
| 246 | Ga0466711_341018 | 3300042615 | Bacteria | 7995 |
| 247 | Ga0466715_079603 | 3300042616 | Bacteria | 222305 |
| 248 | Ga0466715_239006 | 3300042616 | Bacteria | 6426 |
| 249 | Ga0466726_216507 | 3300042619 | Bacteria | 1137 |
| 250 | Ga0466726_229716 | 3300042619 | Bacteria | 10708 |
| 251 | Ga0466728_273031 | 3300042620 | Bacteria | 99357 |
| 252 | Ga0466705_145807 | 3300042612 | Bacteria | 26901 |
| 253 | Ga0466705_265110 | 3300042612 | Bacteria | 14697 |
| 254 | Ga0466732_166988 | 3300042656 | Bacteria | 8400 |
| 255 | Ga0466733_058952 | 3300042659 | Bacteria | 9222 |
| 256 | Ga0466735_068187 | 3300042624 | Bacteria | 1101 |
| 257 | Ga0466735_231465 | 3300042624 | Unclassified | 1536 |
| 258 | Ga0466703_070200 | 3300042636 | Bacteria | 17112 |
| 259 | Ga0466703_116392 | 3300042636 | Bacteria | 3675 |
| 260 | Ga0466703_264934 | 3300042636 | Bacteria | 1517 |
| 261 | Ga0466703_374438 | 3300042636 | Bacteria | 1318 |
| 262 | Ga0466704_140912 | 3300042643 | Bacteria | 6529 |
| 263 | Ga0466701_060976 | 3300042598 | Bacteria | 1228 |
| 264 | Ga0466706_011801 | 3300042599 | Bacteria | 1514 |
| 265 | Ga0466706_071532 | 3300042599 | Bacteria | 22220 |
| 266 | Ga0466700_177947 | 3300042600 | Bacteria | 2043 |
| 267 | Ga0466707_047973 | 3300042601 | Bacteria | 36138 |
| 268 | Ga0466713_025514 | 3300042602 | Bacteria | 114544 |
| 269 | Ga0466713_094496 | 3300042602 | Bacteria | 333875 |
| 270 | Ga0466714_013302 | 3300042603 | Unclassified | 3598 |
| 271 | Ga0466714_064755 | 3300042603 | Unclassified | 1330 |
| 272 | Ga0466698_218723 | 3300042610 | Unclassified | 4219 |
| 273 | 2227076902 | 2225789003 | Unclassified | 2201 |
| 274 | 2227563832 | 2225789004 | Bacteria | 2692 |
| 275 | 2227580741 | 2225789004 | Unclassified | 2516 |
| 276 | IMNBL1DRAFT_c0000979 | 3300000062 | Bacteria | 22035 |
| 277 | JGI24702J35022_10040936 | 3300002462 | Bacteria | 2471 |
| 278 | JGI24705J35276_12181598 | 3300002504 | Unclassified | 1373 |
| 279 | Ga0068305_10329071 | 3300005083 | Bacteria | 2402 |
| 280 | Ga0466657_066028 | 3300042582 | Bacteria | 6121 |
| 281 | Ga0466657_161006 | 3300042582 | Bacteria | 1471 |
| 282 | Ga0466657_215143 | 3300042582 | Unclassified | 1089 |
| 283 | Ga0466690_021497 | 3300042590 | Bacteria | 5264 |
| 284 | Ga0466690_307546 | 3300042590 | Bacteria | 9246 |
| 285 | Ga0466691_035441 | 3300042593 | Bacteria | 6594 |
| 286 | Ga0466691_144642 | 3300042593 | Bacteria | 29342 |
| 287 | Ga0466691_160987 | 3300042593 | Bacteria | 14471 |
| 288 | Ga0466694_276872 | 3300042594 | Bacteria | 2618 |
| 289 | Ga0466696_045836 | 3300042596 | Bacteria | 15844 |
| 290 | Ga0466696_289948 | 3300042596 | Bacteria | 3335 |
| 291 | Ga0123356_10165568 | 3300010049 | Bacteria | 2214 |
| 292 | Ga0123353_11050007 | 3300010167 | Bacteria | 1088 |
| 293 | Ga0123354_10000020 | 3300010882 | Bacteria | 127737 |
| 294 | Ga0123354_10172906 | 3300010882 | Bacteria | 2504 |
| 295 | Ga0466705_416729 | 3300042612 | Bacteria | 3482 |
| 296 | Ga0466711_271276 | 3300042615 | Bacteria | 11657 |
| 297 | Ga0466711_336763 | 3300042615 | Bacteria | 7501 |
| 298 | Ga0466726_061258 | 3300042619 | Bacteria | 6208 |
| 299 | Ga0466729_161626 | 3300042621 | Bacteria | 9810 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01258 | zf-dskA_traR | Prokaryotic dksA/traR C4-type zinc finger | 117 | 149 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01258 | GO:0008270 | zinc ion binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.