Protein Family IF05091
Metagenome
Isolate
276
Members
82
Samples
240
Scaffolds
366.05
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_008952|Ga0466696_008952_3403_4590
- Length
- 395 aa
- Sequence
- MVNEFKYIMSEIKMEKYLVTGGAGFIGANFVKYMLASYSGIQLVILDALTYAGNLATIEDDIDNERCIFVKGDICDRDLANKLFAEYDFRYVVNFAAESHVDRSIEKPQLFLVTNILGTQNLLDAARSAWVTGSDENGYPTWKEGVRFHQVSTDEVYGSLGDTGYFTEKTPLDPRSPYSASKTGADLVVKAYGETYKMPVTITRCSNNYGPYHFPEKLIPLIIKNVLEGKSLPVYGDGSNVRDWLYVEDHCKAIDRVLKNGRVGEVYNIGGHNERQNIQIVKTIIKTIRQLMTEHPEYRKYLRKQVPGADGPPSVEWINDDLITFVRDRLGHDRRYAIDPAKITGELGWTPETDFETGIVKTIQWYLDNQSWVEQIVAGDYLNYYERMYAGRELK
Sample Types
Isolate
13.0%
Metagenome
87.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.9%
Blattidae
23.5%
Unclassified
18.5%
Kalotermitidae
17.3%
Rhinotermitidae
6.2%
Termopsidae
4.9%
Passalidae
2.5%
Hodotermitidae
1.2%
Taxonomy
Archaea
0
Bacteria
271
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2820811576 | Unclassified Actinobacteria Nt197P3bin53 | Isolate | Unclassified |
| 3 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 4 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 14 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 15 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 16 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 17 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 18 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 19 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 20 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 21 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 22 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 28 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 2820874551 | Unclassified Actinobacteria Lab288P1bin85 | Isolate | Unclassified |
| 31 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 32 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 33 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 41 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 42 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 48 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 55 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 56 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 57 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 58 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 59 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 60 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 61 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 62 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 63 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 64 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 65 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 66 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 67 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 68 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 69 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 70 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 71 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 72 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 73 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 74 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 75 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 76 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 77 | 2820823448 | Unclassified Actinobacteria Nt197P3bin113 | Isolate | Unclassified |
| 78 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 79 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 80 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 81 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 82 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_006278 | 3300042599 | Bacteria | 4295 |
| 2 | Ga0466706_173441 | 3300042599 | Bacteria | 12370 |
| 3 | Ga0466706_280658 | 3300042599 | Bacteria | 20199 |
| 4 | Ga0466707_035677 | 3300042601 | Bacteria | 3659 |
| 5 | Ga0466707_149405 | 3300042601 | Bacteria | 1304 |
| 6 | Ga0466707_336561 | 3300042601 | Bacteria | 6454 |
| 7 | Ga0466713_099958 | 3300042602 | Bacteria | 14209 |
| 8 | Ga0466713_144691 | 3300042602 | Bacteria | 3967 |
| 9 | Ga0466719_477020 | 3300042606 | Bacteria | 10258 |
| 10 | Ga0123357_10256645 | 3300009784 | Unclassified | 1857 |
| 11 | Ga0123355_10120638 | 3300009826 | Bacteria | 4069 |
| 12 | Ga0123353_10000263 | 3300010167 | Bacteria | 66472 |
| 13 | 2227522689 | 2225789004 | Bacteria | 3310 |
| 14 | JGI24702J35022_10019032 | 3300002462 | Bacteria | 3739 |
| 15 | JGI24702J35022_10092652 | 3300002462 | Bacteria | 1646 |
| 16 | Ga0068302_10136552 | 3300005071 | Bacteria | 1588 |
| 17 | Ga0466733_218657 | 3300042659 | Bacteria | 1795 |
| 18 | Ga0466705_525159 | 3300042612 | Bacteria | 4543 |
| 19 | Ga0466715_172606 | 3300042616 | Bacteria | 17950 |
| 20 | Ga0466715_196939 | 3300042616 | Bacteria | 11207 |
| 21 | Ga0466715_391355 | 3300042616 | Bacteria | 29146 |
| 22 | Ga0466723_112462 | 3300042618 | Bacteria | 3927 |
| 23 | Ga0466728_043269 | 3300042620 | Bacteria | 14321 |
| 24 | Ga0466729_064521 | 3300042621 | Bacteria | 21158 |
| 25 | Ga0466705_303596 | 3300042612 | Bacteria | 3625 |
| 26 | Ga0466703_072940 | 3300042636 | Bacteria | 2260 |
| 27 | Ga0466703_248655 | 3300042636 | Bacteria | 6527 |
| 28 | Ga0466704_539440 | 3300042643 | Bacteria | 15302 |
| 29 | Ga0466708_032901 | 3300042652 | Bacteria | 14614 |
| 30 | Ga0466708_328094 | 3300042652 | Bacteria | 5485 |
| 31 | Ga0415639_000289 | 3300038395 | Bacteria | 38424 |
| 32 | Ga0415639_076240 | 3300038395 | Bacteria | 14262 |
| 33 | Ga0466690_050105 | 3300042590 | Bacteria | 9533 |
| 34 | Ga0466690_222668 | 3300042590 | Bacteria | 8552 |
| 35 | Ga0466696_033719 | 3300042596 | Bacteria | 8783 |
| 36 | Ga0466713_088278 | 3300042602 | Bacteria | 14277 |
| 37 | Ga0466716_027977 | 3300042605 | Bacteria | 3714 |
| 38 | Ga0466716_054018 | 3300042605 | Bacteria | 10119 |
| 39 | Ga0466716_460906 | 3300042605 | Bacteria | 4417 |
| 40 | Ga0466719_332319 | 3300042606 | Bacteria | 8600 |
| 41 | Ga0466722_172691 | 3300042609 | Bacteria | 9773 |
| 42 | Ga0123356_10005874 | 3300010049 | Bacteria | 12462 |
| 43 | Ga0123353_10111122 | 3300010167 | Bacteria | 4415 |
| 44 | 2227539094 | 2225789004 | Bacteria | 3019 |
| 45 | IMNBL1DRAFT_c0003410 | 3300000062 | Bacteria | 10244 |
| 46 | JGI24698J34947_10039804 | 3300002449 | Bacteria | 2431 |
| 47 | JGI24699J35502_11134022 | 3300002509 | Bacteria | 24829 |
| 48 | Ga0068305_10014385 | 3300005083 | Bacteria | 18520 |
| 49 | Ga0072941_1244440 | 3300005201 | Bacteria | 2022 |
| 50 | Ga0072941_1337849 | 3300005201 | Bacteria | 1985 |
| 51 | Ga0466715_122383 | 3300042616 | Bacteria | 38489 |
| 52 | Ga0466715_123946 | 3300042616 | Bacteria | 25539 |
| 53 | Ga0466723_049242 | 3300042618 | Bacteria | 72461 |
| 54 | Ga0466723_213167 | 3300042618 | Bacteria | 6543 |
| 55 | Ga0466726_173422 | 3300042619 | Bacteria | 1473 |
| 56 | Ga0466728_120564 | 3300042620 | Bacteria | 5804 |
| 57 | Ga0466705_016599 | 3300042612 | Bacteria | 4243 |
| 58 | Ga0466705_029190 | 3300042612 | Bacteria | 4531 |
| 59 | Ga0466705_164983 | 3300042612 | Bacteria | 7543 |
| 60 | Ga0466703_027603 | 3300042636 | Bacteria | 6977 |
| 61 | Ga0466703_048542 | 3300042636 | Bacteria | 4475 |
| 62 | Ga0466703_251310 | 3300042636 | Bacteria | 38401 |
| 63 | Ga0466704_388798 | 3300042643 | Bacteria | 7294 |
| 64 | Ga0466708_179034 | 3300042652 | Bacteria | 11822 |
| 65 | Ga0466708_362098 | 3300042652 | Bacteria | 25589 |
| 66 | Ga0466708_381916 | 3300042652 | Bacteria | 41700 |
| 67 | Ga0456237_0000257 | 3300041968 | Bacteria | 7774 |
| 68 | Ga0466692_193512 | 3300042591 | Bacteria | 2725 |
| 69 | Ga0466696_027830 | 3300042596 | Bacteria | 2976 |
| 70 | Ga0466696_128971 | 3300042596 | Bacteria | 3773 |
| 71 | Ga0466706_271431 | 3300042599 | Bacteria | 2521 |
| 72 | Ga0466713_037186 | 3300042602 | Bacteria | 19061 |
| 73 | Ga0466717_142767 | 3300042604 | Bacteria | 4180 |
| 74 | Ga0466716_032922 | 3300042605 | Bacteria | 30168 |
| 75 | Ga0466716_404342 | 3300042605 | Bacteria | 3458 |
| 76 | Ga0466719_369444 | 3300042606 | Bacteria | 6979 |
| 77 | Ga0466722_072809 | 3300042609 | Bacteria | 18406 |
| 78 | Ga0123355_10196121 | 3300009826 | Bacteria | 2961 |
| 79 | Ga0123353_10000956 | 3300010167 | Bacteria | 35329 |
| 80 | JGI24702J35022_10000263 | 3300002462 | Bacteria | 30153 |
| 81 | JGI24702J35022_10016981 | 3300002462 | Bacteria | 3983 |
| 82 | Ga0068305_10001868 | 3300005083 | Bacteria | 108854 |
| 83 | Ga0068305_10008180 | 3300005083 | Bacteria | 4730 |
| 84 | Ga0466705_526503 | 3300042612 | Bacteria | 3425 |
| 85 | Ga0466710_369962 | 3300042613 | Bacteria | 14640 |
| 86 | Ga0466711_010491 | 3300042615 | Bacteria | 17828 |
| 87 | Ga0466711_036318 | 3300042615 | Bacteria | 24493 |
| 88 | Ga0466711_097109 | 3300042615 | Bacteria | 19294 |
| 89 | Ga0466711_341186 | 3300042615 | Bacteria | 7648 |
| 90 | Ga0466715_064523 | 3300042616 | Bacteria | 22653 |
| 91 | Ga0466715_310093 | 3300042616 | Bacteria | 10260 |
| 92 | Ga0466715_347127 | 3300042616 | Bacteria | 29283 |
| 93 | Ga0466715_409769 | 3300042616 | Bacteria | 4353 |
| 94 | Ga0466715_569211 | 3300042616 | Bacteria | 5221 |
| 95 | Ga0466715_569932 | 3300042616 | Bacteria | 3386 |
| 96 | Ga0466728_427153 | 3300042620 | Bacteria | 44524 |
| 97 | Ga0466709_103866 | 3300042648 | Bacteria | 8749 |
| 98 | Ga0466709_117363 | 3300042648 | Bacteria | 2583 |
| 99 | Ga0466709_255263 | 3300042648 | Bacteria | 22485 |
| 100 | Ga0466708_001960 | 3300042652 | Bacteria | 9171 |
| 101 | Ga0466727_259735 | 3300042655 | Bacteria | 15797 |
| 102 | Ga0415639_021022 | 3300038395 | Bacteria | 26395 |
| 103 | Ga0466690_146535 | 3300042590 | Bacteria | 8131 |
| 104 | Ga0466692_202842 | 3300042591 | Bacteria | 18768 |
| 105 | Ga0466691_088105 | 3300042593 | Bacteria | 24612 |
| 106 | Ga0466691_122576 | 3300042593 | Bacteria | 6242 |
| 107 | Ga0466696_038504 | 3300042596 | Bacteria | 9694 |
| 108 | Ga0466696_370389 | 3300042596 | Bacteria | 6240 |
| 109 | Ga0466696_496289 | 3300042596 | Bacteria | 3273 |
| 110 | Ga0466706_044870 | 3300042599 | Bacteria | 28935 |
| 111 | Ga0466706_168117 | 3300042599 | Bacteria | 7632 |
| 112 | Ga0466700_435087 | 3300042600 | Bacteria | 2093 |
| 113 | Ga0466713_018319 | 3300042602 | Bacteria | 5749 |
| 114 | Ga0466719_160259 | 3300042606 | Bacteria | 1954 |
| 115 | Ga0123356_10125401 | 3300010049 | Bacteria | 2505 |
| 116 | Ga0123356_10328382 | 3300010049 | Bacteria | 1645 |
| 117 | 2227136384 | 2225789004 | Bacteria | 8800 |
| 118 | Ga0466733_108814 | 3300042659 | Bacteria | 2736 |
| 119 | Ga0466723_068881 | 3300042618 | Bacteria | 39250 |
| 120 | Ga0466723_168825 | 3300042618 | Bacteria | 24885 |
| 121 | Ga0466726_113940 | 3300042619 | Bacteria | 4298 |
| 122 | Ga0466726_488927 | 3300042619 | Bacteria | 2848 |
| 123 | Ga0466735_018074 | 3300042624 | Bacteria | 2941 |
| 124 | Ga0466703_235562 | 3300042636 | Bacteria | 13976 |
| 125 | Ga0466704_030043 | 3300042643 | Bacteria | 5937 |
| 126 | Ga0415639_005421 | 3300038395 | Bacteria | 25052 |
| 127 | Ga0415639_006384 | 3300038395 | Bacteria | 18820 |
| 128 | Ga0466706_189380 | 3300042599 | Bacteria | 24268 |
| 129 | Ga0466706_203302 | 3300042599 | Bacteria | 74431 |
| 130 | Ga0466707_294108 | 3300042601 | Bacteria | 21702 |
| 131 | Ga0466719_166271 | 3300042606 | Bacteria | 5300 |
| 132 | Ga0466719_192439 | 3300042606 | Bacteria | 21840 |
| 133 | Ga0466722_074104 | 3300042609 | Bacteria | 13640 |
| 134 | Ga0466722_215548 | 3300042609 | Bacteria | 6444 |
| 135 | Ga0123355_10001017 | 3300009826 | Bacteria | 38926 |
| 136 | Ga0123355_10002507 | 3300009826 | Bacteria | 26013 |
| 137 | Ga0123355_10058583 | 3300009826 | Bacteria | 6230 |
| 138 | Ga0123355_10453186 | 3300009826 | Bacteria | 1615 |
| 139 | Ga0123356_10000049 | 3300010049 | Bacteria | 128747 |
| 140 | IMNBL1DRAFT_c0011326 | 3300000062 | Bacteria | 4178 |
| 141 | JGI24705J35276_12237099 | 3300002504 | Bacteria | 9810 |
| 142 | Ga0466711_018626 | 3300042615 | Bacteria | 17726 |
| 143 | Ga0466726_288292 | 3300042619 | Bacteria | 7039 |
| 144 | Ga0466735_057495 | 3300042624 | Bacteria | 3906 |
| 145 | Ga0466735_124660 | 3300042624 | Bacteria | 3082 |
| 146 | Ga0466735_195449 | 3300042624 | Bacteria | 2454 |
| 147 | Ga0466703_358563 | 3300042636 | Bacteria | 5540 |
| 148 | Ga0466704_211944 | 3300042643 | Bacteria | 2668 |
| 149 | Ga0466704_356038 | 3300042643 | Bacteria | 4297 |
| 150 | Ga0466704_562805 | 3300042643 | Bacteria | 2308 |
| 151 | Ga0466709_234207 | 3300042648 | Bacteria | 2768 |
| 152 | Ga0466708_152497 | 3300042652 | Bacteria | 19960 |
| 153 | Ga0466708_184325 | 3300042652 | Bacteria | 14364 |
| 154 | Ga0466727_128623 | 3300042655 | Bacteria | 11287 |
| 155 | Ga0466727_281806 | 3300042655 | Bacteria | 7556 |
| 156 | Ga0415639_015931 | 3300038395 | Bacteria | 9123 |
| 157 | Ga0415639_067376 | 3300038395 | Bacteria | 9767 |
| 158 | Ga0415639_094985 | 3300038395 | Bacteria | 4383 |
| 159 | Ga0466696_008952 | 3300042596 | Bacteria | 5770 |
| 160 | Ga0466706_152914 | 3300042599 | Bacteria | 14328 |
| 161 | Ga0466707_002475 | 3300042601 | Bacteria | 6878 |
| 162 | Ga0466707_100238 | 3300042601 | Bacteria | 32835 |
| 163 | Ga0466707_407335 | 3300042601 | Bacteria | 27153 |
| 164 | Ga0466713_114108 | 3300042602 | Bacteria | 23218 |
| 165 | Ga0466721_121840 | 3300042608 | Bacteria | 1394 |
| 166 | Ga0123356_10000006 | 3300010049 | Bacteria | 247371 |
| 167 | Ga0123353_10248419 | 3300010167 | Bacteria | 2758 |
| 168 | Ga0123354_10167786 | 3300010882 | Bacteria | 2571 |
| 169 | Ga0068302_10053594 | 3300005071 | Bacteria | 5248 |
| 170 | Ga0068305_10002316 | 3300005083 | Bacteria | 130447 |
| 171 | Ga0466715_361138 | 3300042616 | Bacteria | 34031 |
| 172 | Ga0466715_547539 | 3300042616 | Bacteria | 4784 |
| 173 | Ga0466726_313457 | 3300042619 | Bacteria | 11242 |
| 174 | Ga0466705_353588 | 3300042612 | Bacteria | 4653 |
| 175 | Ga0466735_058875 | 3300042624 | Bacteria | 6734 |
| 176 | Ga0466735_094563 | 3300042624 | Bacteria | 6990 |
| 177 | Ga0466735_202885 | 3300042624 | Bacteria | 5398 |
| 178 | Ga0466704_181256 | 3300042643 | Unclassified | 6305 |
| 179 | Ga0466708_317007 | 3300042652 | Bacteria | 5372 |
| 180 | Ga0466727_174513 | 3300042655 | Bacteria | 4944 |
| 181 | Ga0415639_005556 | 3300038395 | Unclassified | 16852 |
| 182 | Ga0466656_271731 | 3300042550 | Bacteria | 2136 |
| 183 | Ga0466691_153443 | 3300042593 | Bacteria | 5100 |
| 184 | Ga0466694_307328 | 3300042594 | Bacteria | 18402 |
| 185 | Ga0466699_175190 | 3300042597 | Unclassified | 4676 |
| 186 | Ga0466706_017674 | 3300042599 | Bacteria | 37382 |
| 187 | Ga0466706_034747 | 3300042599 | Bacteria | 2657 |
| 188 | Ga0466706_236505 | 3300042599 | Bacteria | 51327 |
| 189 | Ga0466719_174583 | 3300042606 | Bacteria | 4280 |
| 190 | Ga0466722_029126 | 3300042609 | Bacteria | 18315 |
| 191 | Ga0123355_10019072 | 3300009826 | Bacteria | 10911 |
| 192 | Ga0123356_10032737 | 3300010049 | Bacteria | 4862 |
| 193 | Ga0123353_10068342 | 3300010167 | Bacteria | 5705 |
| 194 | Ga0123353_10200428 | 3300010167 | Bacteria | 3140 |
| 195 | Ga0123353_10359769 | 3300010167 | Bacteria | 2188 |
| 196 | Ga0123353_10437036 | 3300010167 | Bacteria | 1932 |
| 197 | JGI24703J35330_11748558 | 3300002501 | Bacteria | 19938 |
| 198 | Ga0466733_161909 | 3300042659 | Bacteria | 5531 |
| 199 | Ga0466705_463006 | 3300042612 | Bacteria | 7328 |
| 200 | Ga0466712_181899 | 3300042614 | Bacteria | 1771 |
| 201 | Ga0466726_426327 | 3300042619 | Bacteria | 3048 |
| 202 | Ga0466729_237421 | 3300042621 | Bacteria | 1637 |
| 203 | Ga0466735_015857 | 3300042624 | Bacteria | 10820 |
| 204 | Ga0466703_340200 | 3300042636 | Bacteria | 6090 |
| 205 | Ga0466709_200775 | 3300042648 | Bacteria | 2958 |
| 206 | Ga0466727_052310 | 3300042655 | Bacteria | 17242 |
| 207 | Ga0466727_102955 | 3300042655 | Bacteria | 4906 |
| 208 | Ga0466727_263308 | 3300042655 | Bacteria | 66130 |
| 209 | Ga0415639_019547 | 3300038395 | Bacteria | 5586 |
| 210 | Ga0466690_053590 | 3300042590 | Bacteria | 10824 |
| 211 | Ga0466690_242664 | 3300042590 | Bacteria | 7166 |
| 212 | Ga0466690_268394 | 3300042590 | Bacteria | 26713 |
| 213 | Ga0466696_030667 | 3300042596 | Bacteria | 6716 |
| 214 | Ga0466696_165163 | 3300042596 | Bacteria | 9403 |
| 215 | Ga0466696_185558 | 3300042596 | Bacteria | 17647 |
| 216 | Ga0466706_009227 | 3300042599 | Bacteria | 3720 |
| 217 | Ga0466707_357331 | 3300042601 | Bacteria | 4079 |
| 218 | Ga0466713_001894 | 3300042602 | Bacteria | 14193 |
| 219 | Ga0466719_333013 | 3300042606 | Bacteria | 4610 |
| 220 | Ga0123355_10000018 | 3300009826 | Bacteria | 155505 |
| 221 | Ga0123355_10006101 | 3300009826 | Bacteria | 17776 |
| 222 | Ga0123356_10000751 | 3300010049 | Bacteria | 35888 |
| 223 | Ga0123356_10003923 | 3300010049 | Bacteria | 15482 |
| 224 | Ga0123356_10013647 | 3300010049 | Bacteria | 7831 |
| 225 | Ga0123353_10834273 | 3300010167 | Bacteria | 1266 |
| 226 | 2227649076 | 2225789004 | Unclassified | 2012 |
| 227 | IMNBL1DRAFT_c0000713 | 3300000062 | Bacteria | 26512 |
| 228 | IMNBL1DRAFT_c0009456 | 3300000062 | Bacteria | 4809 |
| 229 | Ga0466711_038539 | 3300042615 | Bacteria | 5775 |
| 230 | Ga0466715_553051 | 3300042616 | Bacteria | 2582 |
| 231 | Ga0466723_186440 | 3300042618 | Bacteria | 54567 |
| 232 | Ga0466726_014329 | 3300042619 | Bacteria | 22133 |
| 233 | Ga0466729_029764 | 3300042621 | Bacteria | 10821 |
| 234 | Ga0466705_310521 | 3300042612 | Bacteria | 78321 |
| 235 | Ga0466729_204287 | 3300042621 | Bacteria | 3344 |
| 236 | Ga0466727_055934 | 3300042655 | Bacteria | 4382 |
| 237 | Ga0415639_031107 | 3300038395 | Bacteria | 4185 |
| 238 | Ga0466690_185946 | 3300042590 | Bacteria | 26397 |
| 239 | Ga0466690_231693 | 3300042590 | Bacteria | 7319 |
| 240 | Ga0466691_154191 | 3300042593 | Bacteria | 40215 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01370 | Epimerase | NAD dependent epimerase/dehydratase family | 18 | 270 | 0.97 |
| PF16363 | GDP_Man_Dehyd | GDP-mannose 4,6 dehydratase | 18 | 361 | 0.88 |
| PF02719 | Polysacc_synt_2 | Polysaccharide biosynthesis protein | 18 | 131 | 0.86 |
| PF07993 | NAD_binding_4 | Male sterility protein | 19 | 207 | 0.86 |
| PF04321 | RmlD_sub_bind | RmlD substrate binding domain | 17 | 237 | 0.76 |
| PF01073 | 3Beta_HSD | 3-beta hydroxysteroid dehydrogenase/isomerase family | 18 | 250 | 0.74 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.