Protein Family IF05040
Metagenome
Metatranscriptome
Isolate
492
Members
125
Samples
457
Scaffolds
108.01
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_312337|Ga0466694_312337_2938_3336
- Length
- 132 aa
- Sequence
- MGYFYCTIDKDQLIINKKTKQKMKIHIKKGDQVKVIAGDSKGQHGKVLEVITDKYRALVEGTNLVSKHTKANAKTPKGGIVKKEAPIHISNLMVVDNKGNATRIGRRLSEPKKTGEKPKLVRYSKKTGEEIK
Sample Types
Isolate
7.1%
Metagenome
92.3%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.8%
Blattidae
13.9%
Unclassified
13.9%
Kalotermitidae
12.2%
Rhinotermitidae
4.3%
Passalidae
3.5%
Culicidae
3.5%
Drosophilidae
2.6%
Armadillidiidae
2.6%
Termopsidae
2.6%
Formicidae
1.7%
Hodotermitidae
0.9%
Bombycidae
0.9%
Tenebrionidae
0.9%
Hydrophilidae
0.9%
Daphniidae
0.9%
Taxonomy
Archaea
0
Bacteria
455
Eukaryota
0
Viruses
0
Unclassified
37
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 2 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 3 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 4 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 7 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 11 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 27 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 30 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300005311 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 1 gut | Metagenome | Drosophilidae |
| 33 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 38 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 39 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 40 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 43 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 44 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 45 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 46 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 47 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 50 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 51 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 53 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 54 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 55 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 56 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 57 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 58 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 59 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 60 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 61 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 62 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 63 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 64 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 65 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 66 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 67 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 68 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 69 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 70 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 71 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 72 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 73 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 74 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 75 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 76 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 77 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 78 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 79 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 80 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 81 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 82 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 83 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 84 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 85 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 86 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 87 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 88 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 89 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 90 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 91 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 92 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 93 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 94 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 95 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 96 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 97 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 98 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 99 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 100 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 101 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 102 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 103 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 104 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 105 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 106 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 107 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 108 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 109 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 110 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 111 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 112 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 113 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 114 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 115 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 116 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 117 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 118 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 119 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 120 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 121 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 122 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 123 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 124 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 125 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_081740 | 3300042611 | Bacteria | 1806 |
| 2 | Ga0466697_155131 | 3300042611 | Bacteria | 1354 |
| 3 | Ga0466732_393822 | 3300042656 | Bacteria | 1082 |
| 4 | Ga0466733_017210 | 3300042659 | Bacteria | 20046 |
| 5 | Ga0466733_122413 | 3300042659 | Bacteria | 26318 |
| 6 | Ga0466733_154021 | 3300042659 | Bacteria | 1399 |
| 7 | Ga0466710_059363 | 3300042613 | Bacteria | 1012 |
| 8 | Ga0466710_317979 | 3300042613 | Bacteria | 1689 |
| 9 | Ga0466718_106160 | 3300042617 | Bacteria | 1001 |
| 10 | Ga0466729_310854 | 3300042621 | Bacteria | 3061 |
| 11 | Ga0466734_152347 | 3300042623 | Bacteria | 1028 |
| 12 | Ga0466735_000099 | 3300042624 | Bacteria | 1292 |
| 13 | Ga0466735_207348 | 3300042624 | Bacteria | 2404 |
| 14 | Ga0466703_279649 | 3300042636 | Bacteria | 29017 |
| 15 | Ga0466703_369160 | 3300042636 | Bacteria | 28465 |
| 16 | Ga0466704_118855 | 3300042643 | Unclassified | 1394 |
| 17 | Ga0466704_261386 | 3300042643 | Unclassified | 1265 |
| 18 | Ga0466724_28901 | 3300042649 | Bacteria | 1691 |
| 19 | Ga0466724_51175 | 3300042649 | Bacteria | 1925 |
| 20 | Ga0466724_56501 | 3300042649 | Bacteria | 2269 |
| 21 | Ga0466708_147523 | 3300042652 | Bacteria | 9393 |
| 22 | Ga0160441_100013 | 3300012825 | Bacteria | 353830 |
| 23 | Ga0160472_102661 | 3300012839 | Bacteria | 3914 |
| 24 | Ga0160445_100209 | 3300012847 | Bacteria | 43715 |
| 25 | Ga0160434_100034 | 3300012850 | Unclassified | 118700 |
| 26 | Ga0466693_235842 | 3300042592 | Bacteria | 1902 |
| 27 | Ga0466691_003965 | 3300042593 | Bacteria | 1367 |
| 28 | Ga0466694_257882 | 3300042594 | Bacteria | 3725 |
| 29 | Ga0466696_350760 | 3300042596 | Bacteria | 7322 |
| 30 | Ga0466699_054231 | 3300042597 | Bacteria | 7834 |
| 31 | Ga0123357_10266300 | 3300009784 | Unclassified | 1800 |
| 32 | Ga0123356_10069721 | 3300010049 | Bacteria | 3297 |
| 33 | Ga0123356_10139591 | 3300010049 | Bacteria | 2389 |
| 34 | Ga0123356_10620867 | 3300010049 | Bacteria | 1247 |
| 35 | Ga0123353_10407052 | 3300010167 | Bacteria | 2022 |
| 36 | Ga0123353_10825173 | 3300010167 | Bacteria | 1276 |
| 37 | Ga0123353_10940966 | 3300010167 | Unclassified | 1170 |
| 38 | Ga0123354_10082829 | 3300010882 | Bacteria | 4519 |
| 39 | 2227505183 | 2225789004 | Bacteria | 18874 |
| 40 | IMNBL1DRAFT_c0021233 | 3300000062 | Bacteria | 2605 |
| 41 | JGI24695J34938_10038127 | 3300002450 | Unclassified | 2179 |
| 42 | JGI24696J40584_12961242 | 3300002834 | Bacteria | 12515 |
| 43 | Ga0068305_10010112 | 3300005083 | Bacteria | 17726 |
| 44 | Ga0466701_019610 | 3300042598 | Bacteria | 11080 |
| 45 | Ga0466706_040528 | 3300042599 | Unclassified | 5023 |
| 46 | Ga0466713_025268 | 3300042602 | Bacteria | 1366 |
| 47 | Ga0466713_113019 | 3300042602 | Bacteria | 16771 |
| 48 | Ga0466714_073586 | 3300042603 | Bacteria | 1706 |
| 49 | Ga0466714_128318 | 3300042603 | Bacteria | 2375 |
| 50 | Ga0466714_129527 | 3300042603 | Bacteria | 1328 |
| 51 | Ga0466717_084324 | 3300042604 | Bacteria | 7393 |
| 52 | Ga0466722_088834 | 3300042609 | Bacteria | 20099 |
| 53 | Ga0466722_143981 | 3300042609 | Bacteria | 20003 |
| 54 | Ga0466698_149544 | 3300042610 | Bacteria | 1582 |
| 55 | Ga0466732_108835 | 3300042656 | Bacteria | 2069 |
| 56 | Ga0466732_234797 | 3300042656 | Bacteria | 1268 |
| 57 | Ga0466733_013347 | 3300042659 | Bacteria | 6976 |
| 58 | Ga0466733_071083 | 3300042659 | Bacteria | 9797 |
| 59 | Ga0466733_188673 | 3300042659 | Unclassified | 7150 |
| 60 | Ga0466710_135467 | 3300042613 | Bacteria | 4196 |
| 61 | Ga0466710_360371 | 3300042613 | Bacteria | 5191 |
| 62 | Ga0466710_407541 | 3300042613 | Bacteria | 1216 |
| 63 | Ga0466712_091015 | 3300042614 | Bacteria | 1915 |
| 64 | Ga0466711_304910 | 3300042615 | Bacteria | 15225 |
| 65 | Ga0466711_486497 | 3300042615 | Bacteria | 6767 |
| 66 | Ga0466728_139914 | 3300042620 | Bacteria | 13626 |
| 67 | Ga0466731_016159 | 3300042622 | Bacteria | 48336 |
| 68 | Ga0466734_158837 | 3300042623 | Bacteria | 1241 |
| 69 | Ga0466735_199067 | 3300042624 | Bacteria | 3377 |
| 70 | Ga0466735_231792 | 3300042624 | Bacteria | 1893 |
| 71 | Ga0466735_232692 | 3300042624 | Bacteria | 20733 |
| 72 | Ga0466724_66981 | 3300042649 | Bacteria | 17748 |
| 73 | Ga0466725_427112 | 3300042654 | Bacteria | 8748 |
| 74 | Ga0233288_1033617 | 3300022232 | Bacteria | 830 |
| 75 | Ga0265387_1001088 | 3300024582 | Bacteria | 4020 |
| 76 | Ga0265387_1074594 | 3300024582 | Bacteria | 660 |
| 77 | Ga0466656_029522 | 3300042550 | Bacteria | 1420 |
| 78 | Ga0466657_000990 | 3300042582 | Bacteria | 1099 |
| 79 | Ga0466657_093383 | 3300042582 | Bacteria | 1412 |
| 80 | Ga0466694_312337 | 3300042594 | Bacteria | 5792 |
| 81 | Ga0466694_387483 | 3300042594 | Bacteria | 1862 |
| 82 | Ga0466695_330687 | 3300042595 | Bacteria | 7524 |
| 83 | Ga0466699_102625 | 3300042597 | Bacteria | 3424 |
| 84 | Ga0123357_10360950 | 3300009784 | Bacteria | 1376 |
| 85 | Ga0123356_10020734 | 3300010049 | Bacteria | 6216 |
| 86 | Ga0123356_11111957 | 3300010049 | Bacteria | 958 |
| 87 | Ga0123356_11282278 | 3300010049 | Bacteria | 896 |
| 88 | Ga0123356_13078575 | 3300010049 | Unclassified | 581 |
| 89 | Ga0123356_13367748 | 3300010049 | Unclassified | 555 |
| 90 | Ga0123353_10334608 | 3300010167 | Bacteria | 2290 |
| 91 | Ga0123353_10347257 | 3300010167 | Bacteria | 2238 |
| 92 | Ga0123353_10367522 | 3300010167 | Bacteria | 2158 |
| 93 | Ga0123353_10474340 | 3300010167 | Bacteria | 1833 |
| 94 | Ga0123354_10157620 | 3300010882 | Bacteria | 2714 |
| 95 | Ga0123354_10225873 | 3300010882 | Bacteria | 1973 |
| 96 | Ga0160442_100009 | 3300012806 | Bacteria | 498468 |
| 97 | IMNBGM34_c012325 | 3300000036 | Bacteria | 1072 |
| 98 | IMNBL1DRAFT_c0000677 | 3300000062 | Bacteria | 27305 |
| 99 | IMNBL1DRAFT_c0086462 | 3300000062 | Bacteria | 868 |
| 100 | IMNBL1DRAFT_c0102402 | 3300000062 | Bacteria | 768 |
| 101 | JGI24702J35022_10015899 | 3300002462 | Bacteria | 4132 |
| 102 | JGI24702J35022_10112412 | 3300002462 | Unclassified | 1498 |
| 103 | JGI24705J35276_12238295 | 3300002504 | Bacteria | 18753 |
| 104 | JGI24696J40584_12934099 | 3300002834 | Bacteria | 1532 |
| 105 | Ga0072940_1209539 | 3300005200 | Bacteria | 1159 |
| 106 | Ga0104045_1004870 | 3300007085 | Bacteria | 2136 |
| 107 | Ga0104045_1006450 | 3300007085 | Bacteria | 4697 |
| 108 | Ga0466701_079737 | 3300042598 | Bacteria | 4326 |
| 109 | Ga0466701_085799 | 3300042598 | Bacteria | 4596 |
| 110 | Ga0466706_033523 | 3300042599 | Bacteria | 1414 |
| 111 | Ga0466707_360699 | 3300042601 | Bacteria | 17316 |
| 112 | Ga0466713_050425 | 3300042602 | Bacteria | 12094 |
| 113 | Ga0466714_061236 | 3300042603 | Bacteria | 3761 |
| 114 | Ga0466714_084939 | 3300042603 | Bacteria | 1965 |
| 115 | Ga0466714_130290 | 3300042603 | Bacteria | 1875 |
| 116 | Ga0466716_248006 | 3300042605 | Bacteria | 34292 |
| 117 | Ga0466698_075067 | 3300042610 | Bacteria | 3475 |
| 118 | Ga0466697_227173 | 3300042611 | Bacteria | 2458 |
| 119 | Ga0466732_276842 | 3300042656 | Bacteria | 4862 |
| 120 | Ga0466733_091282 | 3300042659 | Bacteria | 1842 |
| 121 | Ga0466733_181233 | 3300042659 | Unclassified | 1415 |
| 122 | Ga0466733_220977 | 3300042659 | Bacteria | 23380 |
| 123 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 124 | Ga0466705_476907 | 3300042612 | Bacteria | 6382 |
| 125 | Ga0466718_155988 | 3300042617 | Bacteria | 1347 |
| 126 | Ga0466723_200321 | 3300042618 | Bacteria | 3904 |
| 127 | Ga0466728_398537 | 3300042620 | Bacteria | 1231 |
| 128 | Ga0466729_189320 | 3300042621 | Bacteria | 5668 |
| 129 | Ga0466734_003771 | 3300042623 | Bacteria | 4944 |
| 130 | Ga0466702_086008 | 3300042635 | Bacteria | 1203 |
| 131 | Ga0466703_039404 | 3300042636 | Bacteria | 7439 |
| 132 | Ga0466704_115291 | 3300042643 | Bacteria | 19465 |
| 133 | Ga0466704_275531 | 3300042643 | Bacteria | 1804 |
| 134 | Ga0466709_379753 | 3300042648 | Bacteria | 47793 |
| 135 | Ga0466724_65579 | 3300042649 | Unclassified | 1784 |
| 136 | Ga0160457_1001220 | 3300012858 | Bacteria | 7723 |
| 137 | Ga0223674_1012164 | 3300021235 | Bacteria | 1385 |
| 138 | Ga0265387_1083405 | 3300024582 | Bacteria | 638 |
| 139 | Ga0415639_157928 | 3300038395 | Bacteria | 1868 |
| 140 | Ga0415639_205541 | 3300038395 | Bacteria | 1351 |
| 141 | Ga0466693_000526 | 3300042592 | Bacteria | 4232 |
| 142 | Ga0466694_063011 | 3300042594 | Bacteria | 7947 |
| 143 | Ga0466695_282159 | 3300042595 | Bacteria | 1252 |
| 144 | Ga0466696_123857 | 3300042596 | Bacteria | 4366 |
| 145 | Ga0466696_201817 | 3300042596 | Bacteria | 41274 |
| 146 | Ga0466696_398980 | 3300042596 | Bacteria | 15504 |
| 147 | Ga0123357_10414753 | 3300009784 | Bacteria | 1209 |
| 148 | Ga0123356_10107730 | 3300010049 | Bacteria | 2685 |
| 149 | Ga0123356_10345793 | 3300010049 | Bacteria | 1609 |
| 150 | Ga0123356_10753726 | 3300010049 | Bacteria | 1144 |
| 151 | Ga0123356_10836330 | 3300010049 | Bacteria | 1092 |
| 152 | Ga0123356_11065221 | 3300010049 | Bacteria | 977 |
| 153 | Ga0123356_11216215 | 3300010049 | Bacteria | 919 |
| 154 | Ga0123356_12485182 | 3300010049 | Bacteria | 648 |
| 155 | Ga0123356_12494695 | 3300010049 | Bacteria | 647 |
| 156 | Ga0123353_10005558 | 3300010167 | Bacteria | 16577 |
| 157 | 2227065651 | 2225789003 | Bacteria | 685 |
| 158 | IMNBL1DRAFT_c0044921 | 3300000062 | Bacteria | 1447 |
| 159 | AustNasuHG_c1066184 | 3300000089 | Bacteria | 672 |
| 160 | JGI24702J35022_10000489 | 3300002462 | Bacteria | 23998 |
| 161 | JGI24702J35022_10002652 | 3300002462 | Bacteria | 10856 |
| 162 | JGI24702J35022_10168705 | 3300002462 | Bacteria | 1237 |
| 163 | JGI24705J35276_12211055 | 3300002504 | Bacteria | 1844 |
| 164 | Ga0104045_1006496 | 3300007085 | Bacteria | 6140 |
| 165 | Ga0466706_098228 | 3300042599 | Bacteria | 39742 |
| 166 | Ga0466706_110873 | 3300042599 | Bacteria | 3310 |
| 167 | Ga0466706_126288 | 3300042599 | Bacteria | 17453 |
| 168 | Ga0466713_052484 | 3300042602 | Bacteria | 51192 |
| 169 | Ga0466713_129806 | 3300042602 | Bacteria | 35433 |
| 170 | Ga0466714_055538 | 3300042603 | Bacteria | 3028 |
| 171 | Ga0466714_065471 | 3300042603 | Bacteria | 1286 |
| 172 | Ga0466714_068745 | 3300042603 | Bacteria | 1091 |
| 173 | Ga0466714_078083 | 3300042603 | Bacteria | 1145 |
| 174 | Ga0466714_086111 | 3300042603 | Bacteria | 1354 |
| 175 | Ga0466714_090492 | 3300042603 | Unclassified | 1348 |
| 176 | Ga0466717_089646 | 3300042604 | Unclassified | 2405 |
| 177 | Ga0466720_179075 | 3300042607 | Bacteria | 1678 |
| 178 | Ga0466721_311842 | 3300042608 | Bacteria | 1168 |
| 179 | Ga0466722_175291 | 3300042609 | Bacteria | 6835 |
| 180 | Ga0466697_119005 | 3300042611 | Bacteria | 2399 |
| 181 | Ga0466733_026986 | 3300042659 | Bacteria | 3557 |
| 182 | Ga0466733_043044 | 3300042659 | Bacteria | 3047 |
| 183 | Ga0466710_364904 | 3300042613 | Bacteria | 1355 |
| 184 | Ga0466711_464836 | 3300042615 | Bacteria | 36759 |
| 185 | Ga0466718_062077 | 3300042617 | Bacteria | 1782 |
| 186 | Ga0466718_152034 | 3300042617 | Bacteria | 1003 |
| 187 | Ga0466729_312077 | 3300042621 | Bacteria | 1189 |
| 188 | Ga0466735_017313 | 3300042624 | Bacteria | 6644 |
| 189 | Ga0466703_174311 | 3300042636 | Bacteria | 11934 |
| 190 | Ga0466709_266727 | 3300042648 | Bacteria | 3133 |
| 191 | Ga0160453_100007 | 3300012814 | Bacteria | 330009 |
| 192 | Ga0264413_128011 | 3300024493 | Bacteria | 5385 |
| 193 | Ga0466694_205845 | 3300042594 | Bacteria | 1309 |
| 194 | Ga0466695_330118 | 3300042595 | Bacteria | 3346 |
| 195 | Ga0466696_064664 | 3300042596 | Bacteria | 19517 |
| 196 | Ga0466696_468944 | 3300042596 | Bacteria | 1403 |
| 197 | Ga0123355_11483170 | 3300009826 | Bacteria | 663 |
| 198 | Ga0123356_10180704 | 3300010049 | Bacteria | 2131 |
| 199 | Ga0123356_10250472 | 3300010049 | Bacteria | 1849 |
| 200 | Ga0123356_10429717 | 3300010049 | Bacteria | 1465 |
| 201 | Ga0123356_10689677 | 3300010049 | Bacteria | 1190 |
| 202 | Ga0123356_11333091 | 3300010049 | Bacteria | 880 |
| 203 | Ga0123353_10326194 | 3300010167 | Bacteria | 2327 |
| 204 | Ga0123353_10846580 | 3300010167 | Bacteria | 1254 |
| 205 | Ga0123353_11473668 | 3300010167 | Bacteria | 869 |
| 206 | Ga0123353_12411697 | 3300010167 | Bacteria | 629 |
| 207 | Ga0123354_10098063 | 3300010882 | Bacteria | 3989 |
| 208 | Ga0123354_10150445 | 3300010882 | Bacteria | 2823 |
| 209 | Ga0123354_10554937 | 3300010882 | Unclassified | 864 |
| 210 | Ga0123354_10672299 | 3300010882 | Bacteria | 732 |
| 211 | 2226994295 | 2225789003 | Bacteria | 1477 |
| 212 | IMNBGM34_c008498 | 3300000036 | Bacteria | 1309 |
| 213 | AustNasuHG_c1007648 | 3300000089 | Unclassified | 3833 |
| 214 | JGI24702J35022_10015205 | 3300002462 | Bacteria | 4239 |
| 215 | JGI24702J35022_10078783 | 3300002462 | Bacteria | 1783 |
| 216 | JGI24696J40584_12863779 | 3300002834 | Bacteria | 1021 |
| 217 | Ga0074300_1151082 | 3300005311 | Unclassified | 564 |
| 218 | Ga0103267_1000365 | 3300007190 | Bacteria | 19591 |
| 219 | Ga0466706_039865 | 3300042599 | Bacteria | 18164 |
| 220 | Ga0466706_228754 | 3300042599 | Bacteria | 25710 |
| 221 | Ga0466707_157624 | 3300042601 | Bacteria | 13208 |
| 222 | Ga0466713_017440 | 3300042602 | Bacteria | 108493 |
| 223 | Ga0466713_072740 | 3300042602 | Bacteria | 29878 |
| 224 | Ga0466698_145828 | 3300042610 | Bacteria | 6446 |
| 225 | Ga0466698_277409 | 3300042610 | Bacteria | 1439 |
| 226 | Ga0466697_101287 | 3300042611 | Bacteria | 1785 |
| 227 | Ga0466697_117778 | 3300042611 | Bacteria | 3002 |
| 228 | Ga0466705_222636 | 3300042612 | Bacteria | 3771 |
| 229 | Ga0466732_458400 | 3300042656 | Bacteria | 1660 |
| 230 | Ga0466733_052339 | 3300042659 | Bacteria | 35317 |
| 231 | Ga0466705_518509 | 3300042612 | Unclassified | 1627 |
| 232 | Ga0466710_039997 | 3300042613 | Bacteria | 3114 |
| 233 | Ga0466710_200734 | 3300042613 | Bacteria | 4049 |
| 234 | Ga0466710_216045 | 3300042613 | Unclassified | 1105 |
| 235 | Ga0466710_260347 | 3300042613 | Bacteria | 1331 |
| 236 | Ga0466715_177954 | 3300042616 | Bacteria | 14578 |
| 237 | Ga0466715_324314 | 3300042616 | Bacteria | 25350 |
| 238 | Ga0466715_579046 | 3300042616 | Bacteria | 1632 |
| 239 | Ga0466726_368141 | 3300042619 | Bacteria | 7927 |
| 240 | Ga0466730_074662 | 3300042625 | Bacteria | 3234 |
| 241 | Ga0466702_250147 | 3300042635 | Bacteria | 1074 |
| 242 | Ga0466704_035266 | 3300042643 | Bacteria | 32811 |
| 243 | Ga0466704_263776 | 3300042643 | Bacteria | 1145 |
| 244 | Ga0466704_541626 | 3300042643 | Bacteria | 3198 |
| 245 | Ga0466709_208437 | 3300042648 | Bacteria | 82349 |
| 246 | Ga0466725_213877 | 3300042654 | Bacteria | 2875 |
| 247 | Ga0466727_306395 | 3300042655 | Bacteria | 1162 |
| 248 | Ga0160455_100062 | 3300012837 | Bacteria | 204480 |
| 249 | Ga0160448_111592 | 3300012854 | Bacteria | 1789 |
| 250 | Ga0265387_1000159 | 3300024582 | Bacteria | 12397 |
| 251 | Ga0466657_388182 | 3300042582 | Bacteria | 1448 |
| 252 | Ga0466690_099811 | 3300042590 | Bacteria | 17385 |
| 253 | Ga0466694_094186 | 3300042594 | Bacteria | 1774 |
| 254 | Ga0466695_272796 | 3300042595 | Bacteria | 4403 |
| 255 | Ga0123357_10491213 | 3300009784 | Bacteria | 1028 |
| 256 | Ga0123357_10653116 | 3300009784 | Bacteria | 777 |
| 257 | Ga0123356_10374194 | 3300010049 | Bacteria | 1555 |
| 258 | Ga0123356_11436042 | 3300010049 | Unclassified | 849 |
| 259 | Ga0123353_10016319 | 3300010167 | Bacteria | 10850 |
| 260 | 2227606019 | 2225789004 | Bacteria | 2298 |
| 261 | IMNBL1DRAFT_c0000355 | 3300000062 | Bacteria | 38787 |
| 262 | IMNBL1DRAFT_c0000682 | 3300000062 | Bacteria | 27226 |
| 263 | IMNBL1DRAFT_c0012577 | 3300000062 | Bacteria | 3860 |
| 264 | JGI24702J35022_10000437 | 3300002462 | Bacteria | 25160 |
| 265 | JGI24702J35022_10807364 | 3300002462 | Unclassified | 584 |
| 266 | JGI24705J35276_12218848 | 3300002504 | Unclassified | 2170 |
| 267 | JGI24699J35502_11133946 | 3300002509 | Bacteria | 20622 |
| 268 | JGI24696J40584_12782221 | 3300002834 | Bacteria | 838 |
| 269 | JGI24696J40584_12933824 | 3300002834 | Bacteria | 1527 |
| 270 | Ga0072941_1681070 | 3300005201 | Bacteria | 805 |
| 271 | Ga0103267_1000029 | 3300007190 | Bacteria | 51888 |
| 272 | Ga0103268_1000539 | 3300007192 | Bacteria | 11296 |
| 273 | Ga0123357_10000278 | 3300009784 | Bacteria | 48976 |
| 274 | Ga0466701_064576 | 3300042598 | Bacteria | 1584 |
| 275 | Ga0466714_019400 | 3300042603 | Bacteria | 4888 |
| 276 | Ga0466714_156840 | 3300042603 | Unclassified | 1051 |
| 277 | Ga0466714_167415 | 3300042603 | Bacteria | 3324 |
| 278 | Ga0466717_218016 | 3300042604 | Bacteria | 1118 |
| 279 | Ga0466722_033596 | 3300042609 | Bacteria | 3777 |
| 280 | Ga0466722_117304 | 3300042609 | Bacteria | 122884 |
| 281 | Ga0466698_439910 | 3300042610 | Bacteria | 1160 |
| 282 | Ga0466697_159381 | 3300042611 | Bacteria | 3322 |
| 283 | Ga0466697_188880 | 3300042611 | Bacteria | 1758 |
| 284 | Ga0466697_261954 | 3300042611 | Unclassified | 1333 |
| 285 | Ga0466732_240783 | 3300042656 | Bacteria | 1402 |
| 286 | Ga0466733_097212 | 3300042659 | Bacteria | 4274 |
| 287 | Ga0466733_145814 | 3300042659 | Bacteria | 7169 |
| 288 | Ga0466712_133838 | 3300042614 | Unclassified | 2296 |
| 289 | Ga0466711_025270 | 3300042615 | Bacteria | 4616 |
| 290 | Ga0466715_434053 | 3300042616 | Bacteria | 17606 |
| 291 | Ga0466718_050709 | 3300042617 | Unclassified | 1405 |
| 292 | Ga0466728_071780 | 3300042620 | Bacteria | 4317 |
| 293 | Ga0466728_292510 | 3300042620 | Bacteria | 40918 |
| 294 | Ga0466731_316999 | 3300042622 | Bacteria | 1703 |
| 295 | Ga0466734_026297 | 3300042623 | Bacteria | 2489 |
| 296 | Ga0466735_002575 | 3300042624 | Bacteria | 1712 |
| 297 | Ga0466704_533188 | 3300042643 | Bacteria | 20326 |
| 298 | Ga0466709_096380 | 3300042648 | Bacteria | 3964 |
| 299 | Ga0160455_100183 | 3300012837 | Bacteria | 61401 |
| 300 | Ga0264413_151503 | 3300024493 | Unclassified | 1484 |
| 301 | Ga0466656_195940 | 3300042550 | Bacteria | 1554 |
| 302 | Ga0466657_046516 | 3300042582 | Bacteria | 1861 |
| 303 | Ga0466657_263850 | 3300042582 | Bacteria | 1746 |
| 304 | Ga0466690_424459 | 3300042590 | Bacteria | 1323 |
| 305 | Ga0466692_120097 | 3300042591 | Bacteria | 76506 |
| 306 | Ga0466693_443157 | 3300042592 | Bacteria | 2169 |
| 307 | Ga0466696_288578 | 3300042596 | Bacteria | 2369 |
| 308 | Ga0466701_004470 | 3300042598 | Bacteria | 1289 |
| 309 | Ga0123355_10751215 | 3300009826 | Bacteria | 1103 |
| 310 | Ga0123356_10007090 | 3300010049 | Bacteria | 11233 |
| 311 | Ga0123356_10083013 | 3300010049 | Bacteria | 3035 |
| 312 | Ga0123356_10637618 | 3300010049 | Bacteria | 1232 |
| 313 | Ga0123356_11016967 | 3300010049 | Bacteria | 999 |
| 314 | Ga0123353_10002126 | 3300010167 | Bacteria | 24517 |
| 315 | Ga0123353_10076527 | 3300010167 | Bacteria | 5377 |
| 316 | Ga0123353_11035068 | 3300010167 | Bacteria | 1099 |
| 317 | Ga0123353_11394989 | 3300010167 | Bacteria | 901 |
| 318 | Ga0123353_12128904 | 3300010167 | Unclassified | 682 |
| 319 | Ga0123354_10429902 | 3300010882 | Bacteria | 1089 |
| 320 | Ga0123354_10855557 | 3300010882 | Bacteria | 603 |
| 321 | 2227527393 | 2225789004 | Bacteria | 16791 |
| 322 | IMNBL1DRAFT_c0000282 | 3300000062 | Bacteria | 44672 |
| 323 | IMNBL1DRAFT_c0059095 | 3300000062 | Bacteria | 1161 |
| 324 | JGI24698J34947_10045041 | 3300002449 | Bacteria | 2254 |
| 325 | JGI24702J35022_10085658 | 3300002462 | Bacteria | 1711 |
| 326 | JGI24702J35022_10112562 | 3300002462 | Bacteria | 1497 |
| 327 | JGI24705J35276_11958499 | 3300002504 | Bacteria | 802 |
| 328 | Ga0068305_10070669 | 3300005083 | Bacteria | 22554 |
| 329 | Ga0103267_1000167 | 3300007190 | Bacteria | 33708 |
| 330 | Ga0105005_1013820 | 3300007505 | Bacteria | 2043 |
| 331 | Ga0466706_266807 | 3300042599 | Bacteria | 4506 |
| 332 | Ga0466707_296601 | 3300042601 | Bacteria | 7478 |
| 333 | Ga0466707_354355 | 3300042601 | Bacteria | 49155 |
| 334 | Ga0466713_003728 | 3300042602 | Bacteria | 1263 |
| 335 | Ga0466713_124336 | 3300042602 | Bacteria | 24023 |
| 336 | Ga0466713_127060 | 3300042602 | Bacteria | 78606 |
| 337 | Ga0466713_137191 | 3300042602 | Bacteria | 44160 |
| 338 | Ga0466714_088792 | 3300042603 | Bacteria | 2054 |
| 339 | Ga0466717_099066 | 3300042604 | Bacteria | 1173 |
| 340 | Ga0466698_248722 | 3300042610 | Bacteria | 1594 |
| 341 | Ga0466698_418342 | 3300042610 | Bacteria | 6626 |
| 342 | Ga0466697_150762 | 3300042611 | Bacteria | 1109 |
| 343 | Ga0466697_180821 | 3300042611 | Bacteria | 5765 |
| 344 | Ga0466697_216412 | 3300042611 | Bacteria | 1161 |
| 345 | Ga0466705_058835 | 3300042612 | Bacteria | 18299 |
| 346 | Ga0466705_292562 | 3300042612 | Unclassified | 3911 |
| 347 | Ga0466727_352642 | 3300042655 | Bacteria | 45291 |
| 348 | Ga0466733_031543 | 3300042659 | Bacteria | 31583 |
| 349 | Ga0466718_080533 | 3300042617 | Bacteria | 1015 |
| 350 | Ga0466726_377045 | 3300042619 | Bacteria | 2301 |
| 351 | Ga0466729_056072 | 3300042621 | Bacteria | 21161 |
| 352 | Ga0466729_284754 | 3300042621 | Bacteria | 1068 |
| 353 | Ga0466731_383659 | 3300042622 | Bacteria | 2513 |
| 354 | Ga0466703_312581 | 3300042636 | Bacteria | 1674 |
| 355 | Ga0466724_00442 | 3300042649 | Bacteria | 1911 |
| 356 | Ga0160459_104959 | 3300012831 | Bacteria | 1771 |
| 357 | Ga0466656_308780 | 3300042550 | Bacteria | 1934 |
| 358 | Ga0466657_203405 | 3300042582 | Bacteria | 6735 |
| 359 | Ga0466690_313050 | 3300042590 | Bacteria | 12844 |
| 360 | Ga0466690_353367 | 3300042590 | Bacteria | 18402 |
| 361 | Ga0466694_031133 | 3300042594 | Bacteria | 1214 |
| 362 | Ga0466695_283387 | 3300042595 | Bacteria | 1203 |
| 363 | Ga0123356_10073866 | 3300010049 | Bacteria | 3208 |
| 364 | Ga0123356_12132997 | 3300010049 | Bacteria | 700 |
| 365 | Ga0123356_12525093 | 3300010049 | Bacteria | 643 |
| 366 | 2227108587 | 2225789004 | Bacteria | 37724 |
| 367 | 2227153876 | 2225789004 | Bacteria | 1577 |
| 368 | IMNBL1DRAFT_c0096700 | 3300000062 | Bacteria | 800 |
| 369 | JGI24702J35022_10005406 | 3300002462 | Bacteria | 7476 |
| 370 | JGI24702J35022_10017924 | 3300002462 | Bacteria | 3865 |
| 371 | JGI24702J35022_10023308 | 3300002462 | Bacteria | 3347 |
| 372 | JGI24702J35022_10065651 | 3300002462 | Bacteria | 1947 |
| 373 | JGI24702J35022_10118499 | 3300002462 | Bacteria | 1461 |
| 374 | JGI24705J35276_11974027 | 3300002504 | Bacteria | 818 |
| 375 | JGI24705J35276_12214984 | 3300002504 | Bacteria | 1983 |
| 376 | JGI24696J40584_12610444 | 3300002834 | Unclassified | 664 |
| 377 | Ga0072941_1165676 | 3300005201 | Bacteria | 1477 |
| 378 | Ga0466706_043865 | 3300042599 | Bacteria | 1081 |
| 379 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 380 | Ga0466706_191825 | 3300042599 | Bacteria | 26014 |
| 381 | Ga0466707_026195 | 3300042601 | Bacteria | 1679 |
| 382 | Ga0466713_022772 | 3300042602 | Bacteria | 15388 |
| 383 | Ga0466714_014428 | 3300042603 | Bacteria | 2564 |
| 384 | Ga0466714_027526 | 3300042603 | Bacteria | 1120 |
| 385 | Ga0466714_047288 | 3300042603 | Bacteria | 1247 |
| 386 | Ga0466714_059082 | 3300042603 | Bacteria | 46712 |
| 387 | Ga0466714_060717 | 3300042603 | Bacteria | 4570 |
| 388 | Ga0466714_088188 | 3300042603 | Bacteria | 2351 |
| 389 | Ga0466714_101031 | 3300042603 | Bacteria | 79046 |
| 390 | Ga0466714_116698 | 3300042603 | Bacteria | 1324 |
| 391 | Ga0466714_134971 | 3300042603 | Bacteria | 1255 |
| 392 | Ga0466719_257380 | 3300042606 | Bacteria | 1741 |
| 393 | Ga0466697_056790 | 3300042611 | Bacteria | 1125 |
| 394 | Ga0466705_057337 | 3300042612 | Bacteria | 16149 |
| 395 | Ga0466732_038023 | 3300042656 | Bacteria | 1228 |
| 396 | Ga0466733_003819 | 3300042659 | Bacteria | 23682 |
| 397 | Ga0466733_122912 | 3300042659 | Bacteria | 8689 |
| 398 | Ga0466705_519399 | 3300042612 | Unclassified | 1236 |
| 399 | Ga0466710_178175 | 3300042613 | Bacteria | 2134 |
| 400 | Ga0466710_337166 | 3300042613 | Bacteria | 1542 |
| 401 | Ga0466711_047765 | 3300042615 | Bacteria | 35661 |
| 402 | Ga0466711_050658 | 3300042615 | Bacteria | 24311 |
| 403 | Ga0466726_037110 | 3300042619 | Bacteria | 18134 |
| 404 | Ga0466728_028653 | 3300042620 | Bacteria | 1418 |
| 405 | Ga0466729_158104 | 3300042621 | Bacteria | 83475 |
| 406 | Ga0466735_176465 | 3300042624 | Bacteria | 8295 |
| 407 | Ga0466703_008003 | 3300042636 | Bacteria | 11175 |
| 408 | Ga0466703_129918 | 3300042636 | Bacteria | 2028 |
| 409 | Ga0466703_180446 | 3300042636 | Bacteria | 15145 |
| 410 | Ga0466704_055849 | 3300042643 | Bacteria | 53217 |
| 411 | Ga0466724_28405 | 3300042649 | Bacteria | 7792 |
| 412 | Ga0466727_331622 | 3300042655 | Bacteria | 5773 |
| 413 | Ga0160440_100558 | 3300012815 | Bacteria | 10244 |
| 414 | Ga0255809_1005350 | 3300022820 | Bacteria | 2286 |
| 415 | Ga0466657_051535 | 3300042582 | Bacteria | 1823 |
| 416 | Ga0466693_078533 | 3300042592 | Bacteria | 2944 |
| 417 | Ga0466691_018781 | 3300042593 | Bacteria | 22071 |
| 418 | Ga0466694_376149 | 3300042594 | Bacteria | 1762 |
| 419 | Ga0466699_032414 | 3300042597 | Bacteria | 1584 |
| 420 | Ga0123356_10059159 | 3300010049 | Bacteria | 3574 |
| 421 | Ga0123356_10067277 | 3300010049 | Bacteria | 3356 |
| 422 | Ga0123356_10069677 | 3300010049 | Bacteria | 3298 |
| 423 | Ga0123356_10647657 | 3300010049 | Bacteria | 1224 |
| 424 | Ga0123356_11864214 | 3300010049 | Bacteria | 748 |
| 425 | Ga0123356_13284162 | 3300010049 | Bacteria | 562 |
| 426 | Ga0123356_13644862 | 3300010049 | Bacteria | 533 |
| 427 | Ga0123353_10005881 | 3300010167 | Bacteria | 16217 |
| 428 | Ga0123353_10130009 | 3300010167 | Bacteria | 4042 |
| 429 | Ga0123353_10251084 | 3300010167 | Unclassified | 2739 |
| 430 | Ga0123354_10573683 | 3300010882 | Unclassified | 839 |
| 431 | Ga0160465_100054 | 3300012803 | Bacteria | 130977 |
| 432 | 2227133585 | 2225789004 | Bacteria | 8869 |
| 433 | 2227568290 | 2225789004 | Bacteria | 542 |
| 434 | IMNBL1DRAFT_c0019259 | 3300000062 | Bacteria | 2803 |
| 435 | IMNBL1DRAFT_c0149513 | 3300000062 | Bacteria | 600 |
| 436 | JGI24702J35022_10219973 | 3300002462 | Bacteria | 1094 |
| 437 | JGI24702J35022_10461793 | 3300002462 | Unclassified | 774 |
| 438 | JGI24705J35276_11621066 | 3300002504 | Bacteria | 599 |
| 439 | JGI24705J35276_12164010 | 3300002504 | Unclassified | 1249 |
| 440 | JGI24696J40584_12570905 | 3300002834 | Bacteria | 638 |
| 441 | Ga0072940_1132958 | 3300005200 | Bacteria | 3644 |
| 442 | Ga0466701_025996 | 3300042598 | Bacteria | 29910 |
| 443 | Ga0466706_051732 | 3300042599 | Bacteria | 31564 |
| 444 | Ga0466706_169251 | 3300042599 | Bacteria | 2322 |
| 445 | Ga0466707_374739 | 3300042601 | Bacteria | 28797 |
| 446 | Ga0466713_056506 | 3300042602 | Bacteria | 16973 |
| 447 | Ga0466713_112803 | 3300042602 | Bacteria | 145809 |
| 448 | Ga0466714_021817 | 3300042603 | Bacteria | 7986 |
| 449 | Ga0466714_035260 | 3300042603 | Bacteria | 6508 |
| 450 | Ga0466714_122808 | 3300042603 | Bacteria | 1866 |
| 451 | Ga0466714_131305 | 3300042603 | Bacteria | 5157 |
| 452 | Ga0466717_186696 | 3300042604 | Bacteria | 1043 |
| 453 | Ga0466717_309442 | 3300042604 | Bacteria | 3604 |
| 454 | Ga0466716_014479 | 3300042605 | Bacteria | 30537 |
| 455 | Ga0466716_435935 | 3300042605 | Unclassified | 2174 |
| 456 | Ga0466716_532094 | 3300042605 | Bacteria | 21649 |
| 457 | Ga0466722_037837 | 3300042609 | Bacteria | 1625 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.