Protein Family IF04993
Metagenome
Metatranscriptome
Isolate
184
Members
60
Samples
177
Scaffolds
227.5
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_107124|Ga0466694_107124_94_909
- Length
- 271 aa
- Sequence
- MYSNHHLSDADRHFGRHLSCPGGRKDQTGRGVKQWINKNKKNMSAIVKIRDLSKIYNAGENEVRALEKWNLDIESGEFTAIVGPSGSGKTTLLNMIGGLDLPTSGSVEIWDEKEQSFLPLPRKENKLINFRRDNIGFVFQAYNLIPVLTAKENVAFVMDLQGIPAKESAKQAAALLDAVGLGDRMNSRPAKLSGGQQQRVAVARALASRPKFVLADEPTANLDSKSAENLLDIMEKLNRQEGITFIFSTHDPRIMAKARRMIRLEDGKLVD
Sample Types
Isolate
3.8%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.1%
Kalotermitidae
20.3%
Unclassified
15.3%
Formicidae
6.8%
Rhinotermitidae
5.1%
Termopsidae
5.1%
Hodotermitidae
1.7%
Passalidae
1.7%
Taxonomy
Archaea
0
Bacteria
178
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 18 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 30 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 31 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 38 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 41 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 45 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 46 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 47 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 50 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 51 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 52 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 53 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 54 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 55 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 56 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 57 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 58 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 59 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 60 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_067527 | 3300042615 | Bacteria | 2317 |
| 2 | Ga0466711_204397 | 3300042615 | Bacteria | 5667 |
| 3 | Ga0466711_377353 | 3300042615 | Bacteria | 12113 |
| 4 | Ga0466715_046045 | 3300042616 | Bacteria | 6673 |
| 5 | Ga0466715_136811 | 3300042616 | Bacteria | 2254 |
| 6 | Ga0466715_167399 | 3300042616 | Bacteria | 4546 |
| 7 | Ga0466734_083760 | 3300042623 | Bacteria | 4828 |
| 8 | Ga0466703_300215 | 3300042636 | Bacteria | 8137 |
| 9 | Ga0466725_421295 | 3300042654 | Bacteria | 1933 |
| 10 | Ga0466713_077066 | 3300042602 | Bacteria | 3056 |
| 11 | Ga0466713_084636 | 3300042602 | Bacteria | 5068 |
| 12 | Ga0466722_217835 | 3300042609 | Bacteria | 3382 |
| 13 | Ga0466656_064204 | 3300042550 | Bacteria | 13500 |
| 14 | Ga0466693_117182 | 3300042592 | Bacteria | 1755 |
| 15 | Ga0466694_107124 | 3300042594 | Bacteria | 1620 |
| 16 | Ga0466696_257261 | 3300042596 | Bacteria | 6582 |
| 17 | Ga0123357_10305929 | 3300009784 | Bacteria | 1596 |
| 18 | Ga0123357_10459260 | 3300009784 | Unclassified | 1097 |
| 19 | Ga0123355_10345870 | 3300009826 | Bacteria | 1976 |
| 20 | IMNBL1DRAFT_c0004806 | 3300000062 | Bacteria | 7969 |
| 21 | JGI24702J35022_10059075 | 3300002462 | Bacteria | 2048 |
| 22 | JGI24705J35276_12238713 | 3300002504 | Bacteria | 41473 |
| 23 | Ga0103268_1000908 | 3300007192 | Bacteria | 8156 |
| 24 | Ga0123357_10000287 | 3300009784 | Bacteria | 48366 |
| 25 | Ga0466710_170801 | 3300042613 | Bacteria | 1591 |
| 26 | Ga0466715_293848 | 3300042616 | Bacteria | 7345 |
| 27 | Ga0466723_354790 | 3300042618 | Bacteria | 3870 |
| 28 | Ga0466726_235989 | 3300042619 | Bacteria | 2234 |
| 29 | Ga0466731_149279 | 3300042622 | Bacteria | 2927 |
| 30 | Ga0466731_233277 | 3300042622 | Bacteria | 1145 |
| 31 | Ga0466708_094661 | 3300042652 | Bacteria | 5265 |
| 32 | Ga0466713_022199 | 3300042602 | Bacteria | 14706 |
| 33 | Ga0466721_046443 | 3300042608 | Bacteria | 1322 |
| 34 | Ga0466722_231908 | 3300042609 | Bacteria | 14669 |
| 35 | Ga0466657_170615 | 3300042582 | Bacteria | 2704 |
| 36 | Ga0466691_102339 | 3300042593 | Bacteria | 29197 |
| 37 | Ga0123356_10949642 | 3300010049 | Bacteria | 1031 |
| 38 | JGI24702J35022_10007898 | 3300002462 | Bacteria | 6056 |
| 39 | JGI24702J35022_10030454 | 3300002462 | Bacteria | 2895 |
| 40 | JGI24702J35022_10093974 | 3300002462 | Bacteria | 1635 |
| 41 | JGI24702J35022_10119673 | 3300002462 | Bacteria | 1454 |
| 42 | JGI24699J35502_11134199 | 3300002509 | Bacteria | 53569 |
| 43 | Ga0068302_10075806 | 3300005071 | Bacteria | 1012 |
| 44 | Ga0103265_1003621 | 3300007068 | Bacteria | 2266 |
| 45 | Ga0466697_155996 | 3300042611 | Bacteria | 1539 |
| 46 | Ga0466697_207709 | 3300042611 | Bacteria | 1110 |
| 47 | Ga0466711_349258 | 3300042615 | Bacteria | 8849 |
| 48 | Ga0466715_009826 | 3300042616 | Unclassified | 3931 |
| 49 | Ga0466726_484998 | 3300042619 | Bacteria | 2488 |
| 50 | Ga0466729_120758 | 3300042621 | Bacteria | 1136 |
| 51 | Ga0466709_339199 | 3300042648 | Bacteria | 7848 |
| 52 | Ga0466706_096760 | 3300042599 | Bacteria | 7943 |
| 53 | Ga0466717_309909 | 3300042604 | Bacteria | 1219 |
| 54 | Ga0466719_017016 | 3300042606 | Bacteria | 9087 |
| 55 | Ga0466690_320154 | 3300042590 | Bacteria | 10526 |
| 56 | Ga0466692_117229 | 3300042591 | Bacteria | 56912 |
| 57 | Ga0466694_377270 | 3300042594 | Bacteria | 1368 |
| 58 | Ga0123356_10408283 | 3300010049 | Bacteria | 1497 |
| 59 | Ga0123356_10418024 | 3300010049 | Bacteria | 1482 |
| 60 | Ga0123353_11426828 | 3300010167 | Bacteria | 888 |
| 61 | Ga0102740_1001116 | 3300007140 | Bacteria | 7002 |
| 62 | Ga0123357_10001030 | 3300009784 | Bacteria | 28577 |
| 63 | Ga0466705_197671 | 3300042612 | Bacteria | 8612 |
| 64 | Ga0466705_317321 | 3300042612 | Bacteria | 1938 |
| 65 | Ga0466715_048528 | 3300042616 | Bacteria | 41779 |
| 66 | Ga0466715_308801 | 3300042616 | Bacteria | 11670 |
| 67 | Ga0466726_221205 | 3300042619 | Bacteria | 5376 |
| 68 | Ga0466726_455747 | 3300042619 | Bacteria | 3403 |
| 69 | Ga0466731_042430 | 3300042622 | Bacteria | 1332 |
| 70 | Ga0466731_094638 | 3300042622 | Bacteria | 32908 |
| 71 | Ga0466731_358343 | 3300042622 | Bacteria | 4605 |
| 72 | Ga0466706_005171 | 3300042599 | Bacteria | 20971 |
| 73 | Ga0466706_047413 | 3300042599 | Bacteria | 1325 |
| 74 | Ga0466706_286496 | 3300042599 | Unclassified | 3560 |
| 75 | Ga0466700_082826 | 3300042600 | Bacteria | 16628 |
| 76 | Ga0466713_068311 | 3300042602 | Bacteria | 3840 |
| 77 | Ga0466717_083867 | 3300042604 | Bacteria | 2166 |
| 78 | Ga0466716_486983 | 3300042605 | Bacteria | 4390 |
| 79 | Ga0466719_014975 | 3300042606 | Bacteria | 21358 |
| 80 | Ga0255786_1014514 | 3300022815 | Bacteria | 1050 |
| 81 | Ga0466690_130158 | 3300042590 | Bacteria | 3276 |
| 82 | Ga0466690_316351 | 3300042590 | Bacteria | 5344 |
| 83 | Ga0466690_390453 | 3300042590 | Bacteria | 4044 |
| 84 | Ga0466692_194030 | 3300042591 | Bacteria | 8337 |
| 85 | Ga0466693_202201 | 3300042592 | Bacteria | 5813 |
| 86 | Ga0123356_10194547 | 3300010049 | Bacteria | 2062 |
| 87 | JGI24702J35022_10287935 | 3300002462 | Bacteria | 966 |
| 88 | JGI24696J40584_12960601 | 3300002834 | Bacteria | 7737 |
| 89 | Ga0466712_162619 | 3300042614 | Bacteria | 3032 |
| 90 | Ga0466711_078256 | 3300042615 | Unclassified | 2652 |
| 91 | Ga0466711_318049 | 3300042615 | Bacteria | 7275 |
| 92 | Ga0466715_121132 | 3300042616 | Bacteria | 2503 |
| 93 | Ga0466723_252526 | 3300042618 | Bacteria | 5554 |
| 94 | Ga0466726_495697 | 3300042619 | Bacteria | 1597 |
| 95 | Ga0466731_334161 | 3300042622 | Bacteria | 1648 |
| 96 | Ga0466734_027522 | 3300042623 | Bacteria | 1288 |
| 97 | Ga0466702_005774 | 3300042635 | Bacteria | 2918 |
| 98 | Ga0466708_116965 | 3300042652 | Bacteria | 6945 |
| 99 | Ga0466725_203348 | 3300042654 | Bacteria | 2421 |
| 100 | Ga0466725_439698 | 3300042654 | Bacteria | 1045 |
| 101 | Ga0466706_145246 | 3300042599 | Bacteria | 1065 |
| 102 | Ga0466716_030431 | 3300042605 | Bacteria | 13924 |
| 103 | Ga0466716_153337 | 3300042605 | Bacteria | 17106 |
| 104 | Ga0466716_240958 | 3300042605 | Bacteria | 25077 |
| 105 | Ga0466716_442880 | 3300042605 | Bacteria | 8188 |
| 106 | Ga0466722_114180 | 3300042609 | Bacteria | 8292 |
| 107 | Ga0466722_219601 | 3300042609 | Bacteria | 13856 |
| 108 | Ga0466656_170444 | 3300042550 | Bacteria | 1170 |
| 109 | Ga0466692_124516 | 3300042591 | Bacteria | 4045 |
| 110 | Ga0466691_032191 | 3300042593 | Bacteria | 15337 |
| 111 | Ga0466696_138095 | 3300042596 | Bacteria | 2896 |
| 112 | Ga0466699_123362 | 3300042597 | Bacteria | 2745 |
| 113 | Ga0123356_10049079 | 3300010049 | Bacteria | 3929 |
| 114 | Ga0123353_10000207 | 3300010167 | Bacteria | 74714 |
| 115 | Ga0068305_10059904 | 3300005083 | Bacteria | 19540 |
| 116 | Ga0068305_10076367 | 3300005083 | Bacteria | 6281 |
| 117 | Ga0466697_117486 | 3300042611 | Bacteria | 4907 |
| 118 | Ga0466697_206331 | 3300042611 | Bacteria | 3320 |
| 119 | Ga0466711_005590 | 3300042615 | Bacteria | 6816 |
| 120 | Ga0466711_081869 | 3300042615 | Bacteria | 19763 |
| 121 | Ga0466709_208608 | 3300042648 | Bacteria | 2955 |
| 122 | Ga0466725_139936 | 3300042654 | Bacteria | 10846 |
| 123 | Ga0466727_074420 | 3300042655 | Bacteria | 1859 |
| 124 | Ga0466706_241114 | 3300042599 | Bacteria | 4751 |
| 125 | Ga0466713_011150 | 3300042602 | Bacteria | 23658 |
| 126 | Ga0466717_009190 | 3300042604 | Bacteria | 2488 |
| 127 | Ga0466716_019503 | 3300042605 | Bacteria | 4620 |
| 128 | Ga0466716_257662 | 3300042605 | Bacteria | 29731 |
| 129 | Ga0466722_267735 | 3300042609 | Bacteria | 1908 |
| 130 | Ga0264413_160568 | 3300024493 | Bacteria | 2363 |
| 131 | Ga0466657_362353 | 3300042582 | Bacteria | 3716 |
| 132 | Ga0466691_139183 | 3300042593 | Unclassified | 10408 |
| 133 | Ga0466694_068225 | 3300042594 | Bacteria | 3328 |
| 134 | Ga0123357_10006307 | 3300009784 | Bacteria | 14433 |
| 135 | Ga0123357_10259100 | 3300009784 | Bacteria | 1843 |
| 136 | Ga0102737_1000357 | 3300007142 | Bacteria | 16113 |
| 137 | Ga0466733_022291 | 3300042659 | Bacteria | 9534 |
| 138 | Ga0466710_346900 | 3300042613 | Bacteria | 1498 |
| 139 | Ga0466711_200598 | 3300042615 | Bacteria | 1334 |
| 140 | Ga0466715_050259 | 3300042616 | Bacteria | 17796 |
| 141 | Ga0466715_471164 | 3300042616 | Bacteria | 10766 |
| 142 | Ga0466723_032550 | 3300042618 | Bacteria | 18253 |
| 143 | Ga0466723_230008 | 3300042618 | Bacteria | 3284 |
| 144 | Ga0466734_074111 | 3300042623 | Bacteria | 1194 |
| 145 | Ga0466725_321030 | 3300042654 | Bacteria | 1929 |
| 146 | Ga0466727_191690 | 3300042655 | Bacteria | 2556 |
| 147 | Ga0466700_380792 | 3300042600 | Bacteria | 2802 |
| 148 | Ga0466713_082426 | 3300042602 | Bacteria | 104514 |
| 149 | Ga0466716_086919 | 3300042605 | Bacteria | 7141 |
| 150 | Ga0466722_107969 | 3300042609 | Bacteria | 4755 |
| 151 | Ga0466722_224834 | 3300042609 | Bacteria | 3134 |
| 152 | Ga0264413_146807 | 3300024493 | Bacteria | 2305 |
| 153 | Ga0466656_306065 | 3300042550 | Bacteria | 1834 |
| 154 | Ga0466696_005760 | 3300042596 | Bacteria | 6048 |
| 155 | Ga0123357_10441857 | 3300009784 | Bacteria | 1138 |
| 156 | Ga0123356_10004750 | 3300010049 | Bacteria | 13993 |
| 157 | Ga0123354_10112591 | 3300010882 | Unclassified | 3581 |
| 158 | Ga0123354_10220664 | 3300010882 | Bacteria | 2016 |
| 159 | JGI24705J35276_12178534 | 3300002504 | Bacteria | 1348 |
| 160 | Ga0466715_088150 | 3300042616 | Bacteria | 6999 |
| 161 | Ga0466734_058541 | 3300042623 | Bacteria | 1272 |
| 162 | Ga0466708_028535 | 3300042652 | Bacteria | 7159 |
| 163 | Ga0466708_207107 | 3300042652 | Bacteria | 5877 |
| 164 | Ga0466727_347817 | 3300042655 | Bacteria | 1329 |
| 165 | Ga0466700_134184 | 3300042600 | Bacteria | 141365 |
| 166 | Ga0466713_027586 | 3300042602 | Bacteria | 1555 |
| 167 | Ga0466716_378766 | 3300042605 | Bacteria | 1295 |
| 168 | Ga0466721_220618 | 3300042608 | Bacteria | 2485 |
| 169 | Ga0466722_103769 | 3300042609 | Bacteria | 5072 |
| 170 | Ga0466722_224279 | 3300042609 | Bacteria | 12236 |
| 171 | Ga0466697_042792 | 3300042611 | Bacteria | 11672 |
| 172 | Ga0466699_191403 | 3300042597 | Bacteria | 3288 |
| 173 | Ga0123357_10096689 | 3300009784 | Bacteria | 3824 |
| 174 | Ga0123357_10185742 | 3300009784 | Bacteria | 2412 |
| 175 | JGI24702J35022_10196858 | 3300002462 | Bacteria | 1151 |
| 176 | JGI24705J35276_12225373 | 3300002504 | Bacteria | 2713 |
| 177 | JGI24705J35276_12231003 | 3300002504 | Bacteria | 3795 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.