Protein Family IF04949
Metagenome
Isolate
309
Members
108
Samples
270
Scaffolds
205.42
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_212240|Ga0466691_212240_4512_5252
- Length
- 246 aa
- Sequence
- VRLPRNVADLFFFKKNYSYLCDPFVHFVQRETVIVLIIKVIEMPGLIGKKIGMTSVFSAEGKNLPCTVIEVGPCVVTQVKTVEKDGYEAVQLGFQDKKEKHTTKPEMGHFNKAGVTPKRHLVEFKQQGTYKAGDVITVEYFNGDTFVDVIGTSKGKGFQGVVKRHGFKGVGEATLGQSDRQRHPGSIGACSYPAKVFKGTRMAGQMGDKRVTVQNLEVIKLIPEHNLMLIKGSVPGAKGAIVVVQK
Sample Types
Isolate
12.6%
Metagenome
87.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
30.8%
Blattidae
14.4%
Unclassified
14.4%
Kalotermitidae
13.5%
Formicidae
5.8%
Cicadellidae
3.8%
Rhinotermitidae
3.8%
Armadillidiidae
2.9%
Termopsidae
2.9%
Passalidae
1.9%
Hydrophilidae
1.9%
Aphrophoridae
1.0%
Elmidae
1.0%
Diaspididae
1.0%
Hodotermitidae
1.0%
Taxonomy
Archaea
0
Bacteria
299
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 2 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 3 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 4 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 5 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 6 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 7 | 641228484 | Candidatus Sulcia muelleri GWSS | Isolate | Cicadellidae |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 12 | 2510917001 | Candidatus Sulcia muelleri PSPU | Isolate | Aphrophoridae |
| 13 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 22 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 28 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 29 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 30 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 31 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 32 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 33 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 34 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 37 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 38 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 39 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 40 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 43 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 44 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 644736337 | Candidatus Sulcia muelleri SMDSEM | Isolate | Unclassified |
| 47 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 48 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 49 | 2540341063 | Candidatus Uzinura diaspidicola ASNER | Isolate | Diaspididae |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 51 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 52 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 55 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 56 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 57 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 58 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 59 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 60 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 61 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 62 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 63 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 64 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 65 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 66 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 67 | 638341057 | Candidatus Sulcia muelleri Hc | Isolate | Cicadellidae |
| 68 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 69 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 70 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 71 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 72 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 73 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 74 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 75 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 76 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 77 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 78 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 79 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 80 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 81 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 82 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 83 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 84 | 646564518 | Candidatus Sulcia muelleri DMIN (unscreened) | Isolate | Cicadellidae |
| 85 | 648028014 | Candidatus Sulcia muelleri CARI | Isolate | Unclassified |
| 86 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 87 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 88 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 89 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 90 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 91 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 92 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 93 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 94 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 95 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 96 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 97 | 2599185120 | Candidatus Sulcia muelleri BGSS | Isolate | Cicadellidae |
| 98 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 99 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 100 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 101 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 102 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 103 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 104 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 105 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 106 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 107 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 108 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_089766 | 3300042612 | Bacteria | 11993 |
| 2 | Ga0466733_052918 | 3300042659 | Bacteria | 1967 |
| 3 | Ga0466701_038225 | 3300042598 | Bacteria | 12164 |
| 4 | Ga0466700_021305 | 3300042600 | Bacteria | 30578 |
| 5 | Ga0466707_023918 | 3300042601 | Bacteria | 27371 |
| 6 | Ga0466707_098650 | 3300042601 | Bacteria | 10173 |
| 7 | Ga0466713_027800 | 3300042602 | Bacteria | 40167 |
| 8 | Ga0466714_160596 | 3300042603 | Bacteria | 3727 |
| 9 | Ga0466716_380101 | 3300042605 | Bacteria | 3190 |
| 10 | Ga0466722_095046 | 3300042609 | Bacteria | 1519 |
| 11 | Ga0466726_024142 | 3300042619 | Bacteria | 22843 |
| 12 | Ga0466728_085697 | 3300042620 | Bacteria | 5860 |
| 13 | Ga0466728_139914 | 3300042620 | Bacteria | 13626 |
| 14 | Ga0466731_155161 | 3300042622 | Bacteria | 1164 |
| 15 | Ga0466735_087599 | 3300042624 | Bacteria | 8967 |
| 16 | Ga0466735_232692 | 3300042624 | Bacteria | 20733 |
| 17 | Ga0466730_002481 | 3300042625 | Unclassified | 1892 |
| 18 | Ga0466703_200506 | 3300042636 | Bacteria | 3211 |
| 19 | Ga0466703_398293 | 3300042636 | Bacteria | 4367 |
| 20 | Ga0466704_300185 | 3300042643 | Bacteria | 2837 |
| 21 | Ga0466709_351791 | 3300042648 | Bacteria | 9960 |
| 22 | Ga0466727_012114 | 3300042655 | Bacteria | 4624 |
| 23 | Ga0123357_10176122 | 3300009784 | Bacteria | 2514 |
| 24 | 2227115821 | 2225789004 | Bacteria | 1723 |
| 25 | 2227191089 | 2225789004 | Unclassified | 1464 |
| 26 | 2227358898 | 2225789004 | Bacteria | 1130 |
| 27 | 2227599341 | 2225789004 | Bacteria | 2350 |
| 28 | IMNBL1DRAFT_c0000677 | 3300000062 | Bacteria | 27305 |
| 29 | JGI24698J34947_10175994 | 3300002449 | Bacteria | 860 |
| 30 | JGI24702J35022_10024045 | 3300002462 | Bacteria | 3293 |
| 31 | Ga0466697_087741 | 3300042611 | Bacteria | 1495 |
| 32 | Ga0466705_216293 | 3300042612 | Bacteria | 17979 |
| 33 | Ga0466701_076335 | 3300042598 | Bacteria | 60822 |
| 34 | Ga0466707_417447 | 3300042601 | Bacteria | 2269 |
| 35 | Ga0466722_043304 | 3300042609 | Bacteria | 5441 |
| 36 | Ga0466715_045203 | 3300042616 | Bacteria | 21834 |
| 37 | Ga0466715_060059 | 3300042616 | Bacteria | 8464 |
| 38 | Ga0466723_198099 | 3300042618 | Bacteria | 9283 |
| 39 | Ga0466726_181824 | 3300042619 | Bacteria | 1471 |
| 40 | Ga0466726_271572 | 3300042619 | Bacteria | 26331 |
| 41 | Ga0466728_018673 | 3300042620 | Bacteria | 22808 |
| 42 | Ga0160432_100007 | 3300012818 | Bacteria | 498694 |
| 43 | Ga0466690_085259 | 3300042590 | Bacteria | 7863 |
| 44 | Ga0466690_287618 | 3300042590 | Bacteria | 16965 |
| 45 | Ga0466692_188243 | 3300042591 | Bacteria | 86416 |
| 46 | Ga0466693_271073 | 3300042592 | Bacteria | 2236 |
| 47 | Ga0466691_045847 | 3300042593 | Bacteria | 49393 |
| 48 | Ga0466729_241472 | 3300042621 | Bacteria | 12387 |
| 49 | Ga0466704_281168 | 3300042643 | Unclassified | 4380 |
| 50 | Ga0466725_246848 | 3300042654 | Bacteria | 2870 |
| 51 | Ga0123353_10107177 | 3300010167 | Bacteria | 4502 |
| 52 | IMNBL1DRAFT_c0000182 | 3300000062 | Bacteria | 55861 |
| 53 | IMNBL1DRAFT_c0025258 | 3300000062 | Bacteria | 2282 |
| 54 | JGI24695J34938_10007437 | 3300002450 | Bacteria | 6410 |
| 55 | JGI24702J35022_10000437 | 3300002462 | Bacteria | 25160 |
| 56 | JGI24705J35276_12129808 | 3300002504 | Bacteria | 1100 |
| 57 | Ga0068305_10003312 | 3300005083 | Bacteria | 66359 |
| 58 | Ga0068305_10026156 | 3300005083 | Bacteria | 20761 |
| 59 | Ga0103267_1000029 | 3300007190 | Bacteria | 51888 |
| 60 | Ga0103268_1000539 | 3300007192 | Bacteria | 11296 |
| 61 | Ga0123357_10000278 | 3300009784 | Bacteria | 48976 |
| 62 | Ga0466733_028819 | 3300042659 | Bacteria | 27870 |
| 63 | Ga0466733_043260 | 3300042659 | Bacteria | 38032 |
| 64 | Ga0466706_028809 | 3300042599 | Bacteria | 4017 |
| 65 | Ga0466706_082645 | 3300042599 | Bacteria | 7494 |
| 66 | Ga0466706_201057 | 3300042599 | Bacteria | 6582 |
| 67 | Ga0466700_256244 | 3300042600 | Bacteria | 8881 |
| 68 | Ga0466707_118550 | 3300042601 | Bacteria | 4293 |
| 69 | Ga0466713_077466 | 3300042602 | Bacteria | 18852 |
| 70 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 71 | Ga0466713_113019 | 3300042602 | Bacteria | 16771 |
| 72 | Ga0466715_206964 | 3300042616 | Bacteria | 26549 |
| 73 | Ga0466723_178800 | 3300042618 | Bacteria | 21394 |
| 74 | Ga0466726_068589 | 3300042619 | Bacteria | 1343 |
| 75 | Ga0466726_144476 | 3300042619 | Bacteria | 21004 |
| 76 | Ga0160456_112168 | 3300012820 | Bacteria | 864 |
| 77 | Ga0466656_332983 | 3300042550 | Bacteria | 3079 |
| 78 | Ga0466690_136616 | 3300042590 | Bacteria | 29160 |
| 79 | Ga0466692_159524 | 3300042591 | Bacteria | 46807 |
| 80 | Ga0466693_110507 | 3300042592 | Bacteria | 60686 |
| 81 | Ga0466696_322276 | 3300042596 | Bacteria | 12983 |
| 82 | Ga0466699_054231 | 3300042597 | Bacteria | 7834 |
| 83 | Ga0466703_060092 | 3300042636 | Bacteria | 6394 |
| 84 | Ga0466703_109702 | 3300042636 | Bacteria | 21153 |
| 85 | Ga0466703_348714 | 3300042636 | Bacteria | 36764 |
| 86 | Ga0466703_369160 | 3300042636 | Bacteria | 28465 |
| 87 | Ga0466704_266068 | 3300042643 | Bacteria | 12383 |
| 88 | Ga0466709_083357 | 3300042648 | Bacteria | 39489 |
| 89 | Ga0466709_118201 | 3300042648 | Bacteria | 25211 |
| 90 | Ga0466708_143755 | 3300042652 | Bacteria | 8647 |
| 91 | Ga0466725_102645 | 3300042654 | Bacteria | 1611 |
| 92 | Ga0123357_10005900 | 3300009784 | Bacteria | 14780 |
| 93 | Ga0123357_10030639 | 3300009784 | Bacteria | 7293 |
| 94 | Ga0123354_10040605 | 3300010882 | Bacteria | 7198 |
| 95 | IMNBL1DRAFT_c0000119 | 3300000062 | Bacteria | 71190 |
| 96 | IMNBL1DRAFT_c0050907 | 3300000062 | Bacteria | 1308 |
| 97 | JGI24699J35502_11015393 | 3300002509 | Bacteria | 1421 |
| 98 | Ga0102740_1000340 | 3300007140 | Bacteria | 13154 |
| 99 | Ga0466697_090597 | 3300042611 | Bacteria | 2716 |
| 100 | Ga0466705_013366 | 3300042612 | Unclassified | 1195 |
| 101 | Ga0466705_301558 | 3300042612 | Bacteria | 7276 |
| 102 | Ga0466707_081263 | 3300042601 | Bacteria | 11553 |
| 103 | Ga0466707_157624 | 3300042601 | Bacteria | 13208 |
| 104 | Ga0466707_190959 | 3300042601 | Bacteria | 10157 |
| 105 | Ga0466713_026981 | 3300042602 | Bacteria | 6138 |
| 106 | Ga0466713_105738 | 3300042602 | Bacteria | 4224 |
| 107 | Ga0466713_119517 | 3300042602 | Bacteria | 7388 |
| 108 | Ga0466716_335360 | 3300042605 | Bacteria | 11224 |
| 109 | Ga0466719_385682 | 3300042606 | Bacteria | 3334 |
| 110 | Ga0466722_253703 | 3300042609 | Bacteria | 9188 |
| 111 | Ga0466711_007105 | 3300042615 | Bacteria | 19648 |
| 112 | Ga0466723_082479 | 3300042618 | Bacteria | 5238 |
| 113 | Ga0466723_093881 | 3300042618 | Bacteria | 35007 |
| 114 | Ga0466728_046729 | 3300042620 | Bacteria | 48709 |
| 115 | Ga0466728_183323 | 3300042620 | Bacteria | 3927 |
| 116 | Ga0466656_281266 | 3300042550 | Bacteria | 2849 |
| 117 | Ga0466657_360416 | 3300042582 | Bacteria | 25893 |
| 118 | Ga0466690_373916 | 3300042590 | Bacteria | 40566 |
| 119 | Ga0466692_149579 | 3300042591 | Bacteria | 83669 |
| 120 | Ga0466691_133039 | 3300042593 | Unclassified | 1563 |
| 121 | Ga0466691_212240 | 3300042593 | Bacteria | 8980 |
| 122 | Ga0466731_340577 | 3300042622 | Bacteria | 1791 |
| 123 | Ga0466703_367008 | 3300042636 | Bacteria | 30950 |
| 124 | Ga0466704_278861 | 3300042643 | Bacteria | 2576 |
| 125 | Ga0466704_415186 | 3300042643 | Bacteria | 17633 |
| 126 | Ga0466704_556947 | 3300042643 | Bacteria | 7415 |
| 127 | Ga0466724_51589 | 3300042649 | Bacteria | 3661 |
| 128 | Ga0466708_050057 | 3300042652 | Bacteria | 16124 |
| 129 | Ga0466727_016158 | 3300042655 | Bacteria | 3925 |
| 130 | Ga0466727_099262 | 3300042655 | Bacteria | 17474 |
| 131 | Ga0123355_10402762 | 3300009826 | Bacteria | 1763 |
| 132 | Ga0123353_10650645 | 3300010167 | Unclassified | 1492 |
| 133 | Ga0123354_10001124 | 3300010882 | Bacteria | 31160 |
| 134 | 2227098316 | 2225789004 | Bacteria | 1805 |
| 135 | 2227261659 | 2225789004 | Unclassified | 1297 |
| 136 | IMNBL1DRAFT_c0004898 | 3300000062 | Bacteria | 7855 |
| 137 | JGI24702J35022_10004749 | 3300002462 | Bacteria | 8038 |
| 138 | JGI24702J35022_10078113 | 3300002462 | Bacteria | 1791 |
| 139 | JGI24699J35502_11134150 | 3300002509 | Bacteria | 37878 |
| 140 | JGI24696J40584_12790682 | 3300002834 | Bacteria | 852 |
| 141 | Ga0466705_097898 | 3300042612 | Bacteria | 6160 |
| 142 | Ga0466706_064416 | 3300042599 | Bacteria | 22081 |
| 143 | Ga0466706_126288 | 3300042599 | Bacteria | 17453 |
| 144 | Ga0466700_428766 | 3300042600 | Bacteria | 1471 |
| 145 | Ga0466707_230802 | 3300042601 | Bacteria | 16904 |
| 146 | Ga0466713_129806 | 3300042602 | Bacteria | 35433 |
| 147 | Ga0466716_024609 | 3300042605 | Bacteria | 2672 |
| 148 | Ga0466716_122468 | 3300042605 | Bacteria | 22074 |
| 149 | Ga0466719_025390 | 3300042606 | Bacteria | 13141 |
| 150 | Ga0466711_062266 | 3300042615 | Bacteria | 2461 |
| 151 | Ga0466715_024383 | 3300042616 | Bacteria | 26866 |
| 152 | Ga0466715_154449 | 3300042616 | Bacteria | 23802 |
| 153 | Ga0466715_266187 | 3300042616 | Bacteria | 25878 |
| 154 | Ga0466718_030954 | 3300042617 | Bacteria | 1827 |
| 155 | Ga0466728_117468 | 3300042620 | Bacteria | 23405 |
| 156 | Ga0466690_248799 | 3300042590 | Bacteria | 9265 |
| 157 | Ga0466693_220652 | 3300042592 | Bacteria | 4010 |
| 158 | Ga0466735_015132 | 3300042624 | Bacteria | 3209 |
| 159 | Ga0466730_009837 | 3300042625 | Bacteria | 325641 |
| 160 | Ga0466703_269865 | 3300042636 | Bacteria | 9316 |
| 161 | Ga0466704_004444 | 3300042643 | Bacteria | 24992 |
| 162 | Ga0466708_014146 | 3300042652 | Bacteria | 33245 |
| 163 | Ga0466727_247918 | 3300042655 | Bacteria | 10698 |
| 164 | Ga0123353_10019531 | 3300010167 | Bacteria | 10075 |
| 165 | Ga0123354_10135024 | 3300010882 | Bacteria | 3091 |
| 166 | Ga0123354_10423215 | 3300010882 | Bacteria | 1104 |
| 167 | IMNBL1DRAFT_c0002428 | 3300000062 | Bacteria | 12971 |
| 168 | IMNBL1DRAFT_c0024209 | 3300000062 | Bacteria | 2360 |
| 169 | JGI24702J35022_10000194 | 3300002462 | Bacteria | 32822 |
| 170 | JGI24702J35022_10002652 | 3300002462 | Bacteria | 10856 |
| 171 | JGI24699J35502_11133712 | 3300002509 | Bacteria | 14056 |
| 172 | JGI24696J40584_12961337 | 3300002834 | Bacteria | 13784 |
| 173 | Ga0103264_1000100 | 3300007188 | Bacteria | 49857 |
| 174 | Ga0466697_125723 | 3300042611 | Bacteria | 1015 |
| 175 | Ga0466700_250859 | 3300042600 | Bacteria | 2498 |
| 176 | Ga0466707_245265 | 3300042601 | Bacteria | 1827 |
| 177 | Ga0466711_289238 | 3300042615 | Bacteria | 45865 |
| 178 | Ga0466715_434053 | 3300042616 | Bacteria | 17606 |
| 179 | Ga0466715_533905 | 3300042616 | Bacteria | 9746 |
| 180 | Ga0466723_348988 | 3300042618 | Bacteria | 4071 |
| 181 | Ga0466723_373256 | 3300042618 | Bacteria | 33738 |
| 182 | Ga0466726_273700 | 3300042619 | Bacteria | 7069 |
| 183 | Ga0466728_105299 | 3300042620 | Bacteria | 55474 |
| 184 | Ga0466728_163688 | 3300042620 | Bacteria | 3561 |
| 185 | Ga0160469_100154 | 3300012824 | Bacteria | 76254 |
| 186 | Ga0160443_100072 | 3300012848 | Bacteria | 188813 |
| 187 | Ga0265387_1051658 | 3300024582 | Unclassified | 740 |
| 188 | Ga0415639_037390 | 3300038395 | Bacteria | 1459 |
| 189 | Ga0466690_191277 | 3300042590 | Bacteria | 10665 |
| 190 | Ga0466692_185674 | 3300042591 | Bacteria | 4041 |
| 191 | Ga0466696_049449 | 3300042596 | Bacteria | 3559 |
| 192 | Ga0466696_367210 | 3300042596 | Bacteria | 9324 |
| 193 | Ga0466734_013641 | 3300042623 | Bacteria | 1854 |
| 194 | Ga0466735_218590 | 3300042624 | Bacteria | 5407 |
| 195 | Ga0466703_150379 | 3300042636 | Bacteria | 5747 |
| 196 | Ga0466703_249699 | 3300042636 | Bacteria | 47455 |
| 197 | Ga0466704_120465 | 3300042643 | Unclassified | 6189 |
| 198 | Ga0466704_311970 | 3300042643 | Bacteria | 2079 |
| 199 | Ga0466709_126917 | 3300042648 | Bacteria | 6968 |
| 200 | Ga0466708_135787 | 3300042652 | Bacteria | 29737 |
| 201 | Ga0466727_117581 | 3300042655 | Bacteria | 2355 |
| 202 | Ga0123356_10196126 | 3300010049 | Bacteria | 2055 |
| 203 | Ga0123354_10025847 | 3300010882 | Bacteria | 9257 |
| 204 | Ga0123354_10717260 | 3300010882 | Bacteria | 694 |
| 205 | 2227527393 | 2225789004 | Bacteria | 16791 |
| 206 | JGI24698J34947_10016845 | 3300002449 | Bacteria | 3965 |
| 207 | JGI24702J35022_10004653 | 3300002462 | Bacteria | 8123 |
| 208 | Ga0466732_073791 | 3300042656 | Bacteria | 2462 |
| 209 | Ga0466732_242870 | 3300042656 | Bacteria | 97652 |
| 210 | Ga0466701_034352 | 3300042598 | Bacteria | 2625 |
| 211 | Ga0466706_177822 | 3300042599 | Bacteria | 1532 |
| 212 | Ga0466706_191825 | 3300042599 | Bacteria | 26014 |
| 213 | Ga0466707_416109 | 3300042601 | Bacteria | 2339 |
| 214 | Ga0466713_022772 | 3300042602 | Bacteria | 15388 |
| 215 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 216 | Ga0466714_101031 | 3300042603 | Bacteria | 79046 |
| 217 | Ga0466716_231031 | 3300042605 | Bacteria | 6941 |
| 218 | Ga0466722_055729 | 3300042609 | Bacteria | 3414 |
| 219 | Ga0466722_161726 | 3300042609 | Bacteria | 14778 |
| 220 | Ga0466698_183996 | 3300042610 | Bacteria | 1362 |
| 221 | Ga0466710_298213 | 3300042613 | Bacteria | 2349 |
| 222 | Ga0466715_016723 | 3300042616 | Bacteria | 13247 |
| 223 | Ga0466656_075682 | 3300042550 | Bacteria | 1570 |
| 224 | Ga0466656_127609 | 3300042550 | Bacteria | 23908 |
| 225 | Ga0466690_168212 | 3300042590 | Bacteria | 11803 |
| 226 | Ga0466692_144683 | 3300042591 | Bacteria | 28602 |
| 227 | Ga0466691_003678 | 3300042593 | Bacteria | 14150 |
| 228 | Ga0466691_204814 | 3300042593 | Bacteria | 23707 |
| 229 | Ga0466694_001267 | 3300042594 | Bacteria | 3382 |
| 230 | Ga0466694_152276 | 3300042594 | Bacteria | 1002 |
| 231 | Ga0466695_344631 | 3300042595 | Bacteria | 1338 |
| 232 | Ga0466735_041724 | 3300042624 | Bacteria | 21992 |
| 233 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 234 | Ga0466704_282160 | 3300042643 | Bacteria | 2982 |
| 235 | Ga0123355_10111854 | 3300009826 | Bacteria | 4264 |
| 236 | 2227144728 | 2225789004 | Bacteria | 1609 |
| 237 | 2227588237 | 2225789004 | Bacteria | 2445 |
| 238 | IMNBL1DRAFT_c0022789 | 3300000062 | Bacteria | 2469 |
| 239 | IMNBL1DRAFT_c0104212 | 3300000062 | Unclassified | 759 |
| 240 | JGI24702J35022_10193867 | 3300002462 | Bacteria | 1160 |
| 241 | Ga0466705_183402 | 3300042612 | Bacteria | 3105 |
| 242 | Ga0466733_122912 | 3300042659 | Bacteria | 8689 |
| 243 | Ga0466733_174455 | 3300042659 | Bacteria | 4998 |
| 244 | Ga0466706_183911 | 3300042599 | Bacteria | 19618 |
| 245 | Ga0466700_315313 | 3300042600 | Bacteria | 7042 |
| 246 | Ga0466713_066156 | 3300042602 | Bacteria | 5649 |
| 247 | Ga0466716_065737 | 3300042605 | Bacteria | 4990 |
| 248 | Ga0466719_204065 | 3300042606 | Bacteria | 20051 |
| 249 | Ga0466719_554685 | 3300042606 | Bacteria | 12056 |
| 250 | Ga0466722_088416 | 3300042609 | Bacteria | 9449 |
| 251 | Ga0466711_050658 | 3300042615 | Bacteria | 24311 |
| 252 | Ga0466726_269193 | 3300042619 | Bacteria | 1082 |
| 253 | Ga0466728_069680 | 3300042620 | Bacteria | 49538 |
| 254 | Ga0466690_032772 | 3300042590 | Bacteria | 29534 |
| 255 | Ga0466690_175771 | 3300042590 | Bacteria | 56622 |
| 256 | Ga0466692_168163 | 3300042591 | Bacteria | 3791 |
| 257 | Ga0466691_039529 | 3300042593 | Bacteria | 29822 |
| 258 | Ga0466696_057464 | 3300042596 | Bacteria | 6383 |
| 259 | Ga0466696_195859 | 3300042596 | Bacteria | 1912 |
| 260 | Ga0466730_020607 | 3300042625 | Bacteria | 3112 |
| 261 | Ga0466730_098534 | 3300042625 | Bacteria | 2323 |
| 262 | Ga0466703_297814 | 3300042636 | Bacteria | 1671 |
| 263 | Ga0466727_016509 | 3300042655 | Bacteria | 1517 |
| 264 | Ga0466727_050462 | 3300042655 | Bacteria | 20965 |
| 265 | Ga0123354_10006670 | 3300010882 | Bacteria | 17209 |
| 266 | JGI24702J35022_10021314 | 3300002462 | Bacteria | 3515 |
| 267 | JGI24705J35276_12174723 | 3300002504 | Bacteria | 1319 |
| 268 | CVPL010W_10000676 | 3300002931 | Bacteria | 64066 |
| 269 | Ga0102734_1000653 | 3300007129 | Bacteria | 9616 |
| 270 | Ga0123357_10000330 | 3300009784 | Bacteria | 44905 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00297 | Ribosomal_L3 | Ribosomal protein L3 | 124 | 221 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.