Protein Family IF04903
Metagenome
Isolate
469
Members
131
Samples
414
Scaffolds
276.19
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_111372|Ga0466691_111372_229_1170
- Length
- 313 aa
- Sequence
- LSSEINAVLLPRSICFATQKGEFQIVAPCKTPLLGDDIKDMTPIGIFDSGYGGLTILEQIREQLPEYDYLYLGDNARSPYGSRSFEVVYEFTLQAVQWLFRQGCRLVILACNTASAKALRTIQQKDLPVIDPQRRVLGVIRPTVENINKITGTCHIGILGTQGTVISRSYPLEIEKLFPGMTVESEACPVWVPLVENNEHDKPGADYFVKQHIENILQKDALIDTLILACTHYPLLEKKIREHLPIGIRLVSQGKLVAESLKDYLCRHPEIESQCSKSATCRFYTTESEEKFSSMASLFLKGKIEAERVSALS
Sample Types
Isolate
11.7%
Metagenome
88.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.8%
Blattidae
22.4%
Unclassified
18.4%
Kalotermitidae
11.2%
Rhinotermitidae
4.8%
Culicidae
3.2%
Passalidae
3.2%
Termopsidae
3.2%
Hydrophilidae
2.4%
Apidae
0.8%
Hodotermitidae
0.8%
Tenebrionidae
0.8%
Taxonomy
Archaea
0
Bacteria
457
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 2 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 3 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 4 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 5 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 11 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 12 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 13 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 14 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 20 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 21 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 22 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 23 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 26 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 27 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 32 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 33 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 34 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 35 | 2820950349 | Unclassified Acidobacteria Lab288P3bin89 | Isolate | Unclassified |
| 36 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 37 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 38 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 41 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 42 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 43 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 44 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 45 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 46 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 47 | 2820716747 | Unclassified Fibrobacteres Nc150P3bin18 | Isolate | Unclassified |
| 48 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 49 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 50 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 51 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 52 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 53 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 54 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 55 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 56 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 57 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 58 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 59 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 60 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 61 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 62 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 63 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 64 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 65 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 66 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 67 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 68 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 69 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 70 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 71 | 2778260939 | Unclassified Fibrobacteres Co191P4bin13 | Isolate | Unclassified |
| 72 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 73 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 74 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 75 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 76 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 77 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 78 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 79 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 80 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 81 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 82 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 83 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 84 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 85 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 86 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 87 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 88 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 89 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 90 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 91 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 92 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 93 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 94 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 95 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 96 | 2820714932 | Unclassified Fibrobacteres Nc150P4bin10 | Isolate | Unclassified |
| 97 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 98 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 99 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 100 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 101 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 102 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 103 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 104 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 105 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 106 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 107 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 108 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 109 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 110 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 111 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 112 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 113 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 114 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 115 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 116 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 117 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 118 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 119 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 120 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 121 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 122 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 123 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 124 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 125 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 126 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 127 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 128 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 129 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 130 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 131 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_176267 | 3300042659 | Bacteria | 10026 |
| 2 | Ga0466712_296790 | 3300042614 | Unclassified | 20050 |
| 3 | Ga0466711_018272 | 3300042615 | Bacteria | 27429 |
| 4 | Ga0466711_434363 | 3300042615 | Bacteria | 2531 |
| 5 | Ga0466715_006426 | 3300042616 | Bacteria | 20601 |
| 6 | Ga0466715_211123 | 3300042616 | Bacteria | 56208 |
| 7 | Ga0466715_563360 | 3300042616 | Bacteria | 2469 |
| 8 | Ga0466728_005517 | 3300042620 | Bacteria | 23116 |
| 9 | 2227433570 | 2225789004 | Bacteria | 5540 |
| 10 | IMNBL1DRAFT_c0000351 | 3300000062 | Bacteria | 38920 |
| 11 | AustNasuHG_c1005112 | 3300000089 | Bacteria | 4690 |
| 12 | AustNasuHG_c1039178 | 3300000089 | Bacteria | 1181 |
| 13 | AustNasuHG_c1040835 | 3300000089 | Bacteria | 1128 |
| 14 | JGI24695J34938_10003154 | 3300002450 | Bacteria | 11729 |
| 15 | JGI24702J35022_10047195 | 3300002462 | Bacteria | 2292 |
| 16 | JGI24702J35022_10120303 | 3300002462 | Bacteria | 1450 |
| 17 | JGI24705J35276_12232155 | 3300002504 | Bacteria | 4209 |
| 18 | JGI24699J35502_11134035 | 3300002509 | Bacteria | 25887 |
| 19 | JGI24696J40584_12953827 | 3300002834 | Bacteria | 2541 |
| 20 | Ga0068305_10006537 | 3300005083 | Bacteria | 27988 |
| 21 | Ga0072941_1006505 | 3300005201 | Bacteria | 32331 |
| 22 | Ga0123357_10102292 | 3300009784 | Bacteria | 3689 |
| 23 | Ga0123353_10000120 | 3300010167 | Bacteria | 93172 |
| 24 | Ga0123354_10093332 | 3300010882 | Bacteria | 4138 |
| 25 | Ga0466729_241494 | 3300042621 | Bacteria | 1785 |
| 26 | Ga0466734_036009 | 3300042623 | Bacteria | 1091 |
| 27 | Ga0466735_085063 | 3300042624 | Bacteria | 13418 |
| 28 | Ga0466735_225961 | 3300042624 | Bacteria | 1074 |
| 29 | Ga0466703_050660 | 3300042636 | Bacteria | 10492 |
| 30 | Ga0466704_149187 | 3300042643 | Bacteria | 2408 |
| 31 | Ga0466704_228411 | 3300042643 | Bacteria | 3890 |
| 32 | Ga0466708_172971 | 3300042652 | Bacteria | 8554 |
| 33 | Ga0466725_085082 | 3300042654 | Bacteria | 5386 |
| 34 | Ga0466727_248051 | 3300042655 | Bacteria | 3737 |
| 35 | Ga0160460_100165 | 3300012845 | Bacteria | 73034 |
| 36 | Ga0466690_266154 | 3300042590 | Bacteria | 16703 |
| 37 | Ga0466695_088514 | 3300042595 | Bacteria | 5230 |
| 38 | Ga0466696_028041 | 3300042596 | Bacteria | 5121 |
| 39 | Ga0466706_089550 | 3300042599 | Bacteria | 17804 |
| 40 | Ga0466706_113167 | 3300042599 | Bacteria | 48207 |
| 41 | Ga0466706_145037 | 3300042599 | Bacteria | 4591 |
| 42 | Ga0466713_071340 | 3300042602 | Bacteria | 5760 |
| 43 | Ga0466716_132536 | 3300042605 | Bacteria | 38589 |
| 44 | Ga0466716_245672 | 3300042605 | Bacteria | 6955 |
| 45 | Ga0466719_146043 | 3300042606 | Bacteria | 3195 |
| 46 | Ga0466722_018511 | 3300042609 | Bacteria | 19543 |
| 47 | Ga0466722_215416 | 3300042609 | Bacteria | 8165 |
| 48 | Ga0466722_261554 | 3300042609 | Bacteria | 74167 |
| 49 | Ga0466732_082754 | 3300042656 | Bacteria | 2338 |
| 50 | Ga0466732_437211 | 3300042656 | Bacteria | 2934 |
| 51 | Ga0466733_062710 | 3300042659 | Bacteria | 13440 |
| 52 | Ga0466733_203604 | 3300042659 | Bacteria | 66833 |
| 53 | Ga0466712_080109 | 3300042614 | Bacteria | 4909 |
| 54 | Ga0466712_143757 | 3300042614 | Bacteria | 17633 |
| 55 | Ga0466711_177833 | 3300042615 | Bacteria | 4077 |
| 56 | Ga0466711_180096 | 3300042615 | Unclassified | 23272 |
| 57 | Ga0466715_070176 | 3300042616 | Bacteria | 53352 |
| 58 | Ga0466715_080012 | 3300042616 | Bacteria | 10209 |
| 59 | Ga0466715_130358 | 3300042616 | Bacteria | 42952 |
| 60 | Ga0466715_257154 | 3300042616 | Bacteria | 62616 |
| 61 | Ga0466715_414445 | 3300042616 | Bacteria | 3228 |
| 62 | Ga0466715_458861 | 3300042616 | Bacteria | 7021 |
| 63 | Ga0466723_023755 | 3300042618 | Bacteria | 10317 |
| 64 | Ga0466723_152458 | 3300042618 | Bacteria | 4902 |
| 65 | Ga0466723_218357 | 3300042618 | Bacteria | 12186 |
| 66 | Ga0466723_288220 | 3300042618 | Bacteria | 30418 |
| 67 | Ga0466728_231685 | 3300042620 | Bacteria | 35846 |
| 68 | Ga0466728_369030 | 3300042620 | Bacteria | 45294 |
| 69 | IMNBL1DRAFT_c0000975 | 3300000062 | Bacteria | 22090 |
| 70 | IMNBL1DRAFT_c0006851 | 3300000062 | Bacteria | 6128 |
| 71 | JGI24702J35022_10001200 | 3300002462 | Bacteria | 16110 |
| 72 | JGI24702J35022_10232692 | 3300002462 | Bacteria | 1066 |
| 73 | Ga0068302_10104184 | 3300005071 | Bacteria | 3253 |
| 74 | Ga0072941_1028155 | 3300005201 | Bacteria | 20261 |
| 75 | Ga0123356_10346416 | 3300010049 | Bacteria | 1608 |
| 76 | Ga0466731_430755 | 3300042622 | Bacteria | 18415 |
| 77 | Ga0466703_074379 | 3300042636 | Bacteria | 18711 |
| 78 | Ga0466703_095941 | 3300042636 | Bacteria | 10067 |
| 79 | Ga0466703_254723 | 3300042636 | Bacteria | 12800 |
| 80 | Ga0466703_405257 | 3300042636 | Bacteria | 23623 |
| 81 | Ga0466709_309597 | 3300042648 | Bacteria | 40669 |
| 82 | Ga0466708_367106 | 3300042652 | Bacteria | 72455 |
| 83 | Ga0466725_243294 | 3300042654 | Bacteria | 41653 |
| 84 | Ga0466727_335761 | 3300042655 | Bacteria | 1554 |
| 85 | Ga0160434_100066 | 3300012850 | Bacteria | 74916 |
| 86 | Ga0466691_111372 | 3300042593 | Bacteria | 20623 |
| 87 | Ga0466694_082024 | 3300042594 | Bacteria | 1741 |
| 88 | Ga0466696_003398 | 3300042596 | Bacteria | 2028 |
| 89 | Ga0466696_033537 | 3300042596 | Bacteria | 4658 |
| 90 | Ga0466696_235123 | 3300042596 | Bacteria | 10174 |
| 91 | Ga0466696_246206 | 3300042596 | Bacteria | 12912 |
| 92 | Ga0466706_008610 | 3300042599 | Bacteria | 7029 |
| 93 | Ga0466706_072928 | 3300042599 | Bacteria | 51016 |
| 94 | Ga0466707_184611 | 3300042601 | Bacteria | 10575 |
| 95 | Ga0466713_007148 | 3300042602 | Bacteria | 11385 |
| 96 | Ga0466713_028910 | 3300042602 | Bacteria | 114900 |
| 97 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 98 | Ga0466713_119672 | 3300042602 | Bacteria | 8538 |
| 99 | Ga0466713_123723 | 3300042602 | Bacteria | 198668 |
| 100 | Ga0466714_075340 | 3300042603 | Bacteria | 5032 |
| 101 | Ga0466717_224973 | 3300042604 | Bacteria | 1928 |
| 102 | Ga0466716_315600 | 3300042605 | Bacteria | 13202 |
| 103 | Ga0466720_042324 | 3300042607 | Bacteria | 26236 |
| 104 | Ga0466697_039481 | 3300042611 | Bacteria | 2926 |
| 105 | Ga0466705_219816 | 3300042612 | Bacteria | 11106 |
| 106 | Ga0466733_109595 | 3300042659 | Bacteria | 8758 |
| 107 | Ga0466710_266618 | 3300042613 | Bacteria | 9048 |
| 108 | Ga0466711_094746 | 3300042615 | Bacteria | 4856 |
| 109 | Ga0466715_081282 | 3300042616 | Bacteria | 8255 |
| 110 | Ga0466715_170971 | 3300042616 | Bacteria | 17415 |
| 111 | Ga0466715_234297 | 3300042616 | Bacteria | 23273 |
| 112 | Ga0466718_116548 | 3300042617 | Bacteria | 1106 |
| 113 | Ga0466728_287482 | 3300042620 | Bacteria | 49534 |
| 114 | 2227067481 | 2225789003 | Bacteria | 3073 |
| 115 | 2227419713 | 2225789004 | Bacteria | 5629 |
| 116 | JGI24698J34947_10001908 | 3300002449 | Bacteria | 11109 |
| 117 | JGI24702J35022_10000676 | 3300002462 | Bacteria | 20761 |
| 118 | JGI24702J35022_10035579 | 3300002462 | Bacteria | 2664 |
| 119 | JGI24702J35022_10042290 | 3300002462 | Bacteria | 2427 |
| 120 | JGI24696J40584_12943825 | 3300002834 | Bacteria | 1788 |
| 121 | JGI24696J40584_12961719 | 3300002834 | Bacteria | 72636 |
| 122 | Ga0068302_10839383 | 3300005071 | Bacteria | 1859 |
| 123 | Ga0068305_10001869 | 3300005083 | Unclassified | 1712 |
| 124 | Ga0068305_10055120 | 3300005083 | Bacteria | 34511 |
| 125 | Ga0072941_1327962 | 3300005201 | Bacteria | 1707 |
| 126 | Ga0123354_10000458 | 3300010882 | Bacteria | 40359 |
| 127 | Ga0123354_10118220 | 3300010882 | Bacteria | 3443 |
| 128 | Ga0466735_026200 | 3300042624 | Bacteria | 2932 |
| 129 | Ga0466735_227675 | 3300042624 | Bacteria | 2555 |
| 130 | Ga0466735_229512 | 3300042624 | Bacteria | 2103 |
| 131 | Ga0466703_019677 | 3300042636 | Bacteria | 1873 |
| 132 | Ga0466703_058592 | 3300042636 | Bacteria | 21876 |
| 133 | Ga0466704_098030 | 3300042643 | Bacteria | 25866 |
| 134 | Ga0466727_235389 | 3300042655 | Bacteria | 27915 |
| 135 | Ga0160460_100002 | 3300012845 | Bacteria | 833437 |
| 136 | Ga0466657_003673 | 3300042582 | Bacteria | 38289 |
| 137 | Ga0466657_228810 | 3300042582 | Bacteria | 1234 |
| 138 | Ga0466690_083426 | 3300042590 | Bacteria | 10586 |
| 139 | Ga0466691_004907 | 3300042593 | Bacteria | 1992 |
| 140 | Ga0466691_084139 | 3300042593 | Bacteria | 17956 |
| 141 | Ga0466696_194073 | 3300042596 | Bacteria | 13847 |
| 142 | Ga0466696_323727 | 3300042596 | Bacteria | 4274 |
| 143 | Ga0466699_041311 | 3300042597 | Bacteria | 2124 |
| 144 | Ga0466701_055721 | 3300042598 | Bacteria | 17089 |
| 145 | Ga0466706_113002 | 3300042599 | Bacteria | 17603 |
| 146 | Ga0466707_064804 | 3300042601 | Bacteria | 33987 |
| 147 | Ga0466713_017321 | 3300042602 | Bacteria | 2128 |
| 148 | Ga0466713_061265 | 3300042602 | Bacteria | 21524 |
| 149 | Ga0466713_095390 | 3300042602 | Bacteria | 16392 |
| 150 | Ga0466714_168628 | 3300042603 | Bacteria | 36223 |
| 151 | Ga0466716_247216 | 3300042605 | Bacteria | 4414 |
| 152 | Ga0466719_183656 | 3300042606 | Bacteria | 8089 |
| 153 | Ga0466719_466443 | 3300042606 | Bacteria | 8952 |
| 154 | Ga0466722_193056 | 3300042609 | Bacteria | 6193 |
| 155 | Ga0466705_191792 | 3300042612 | Bacteria | 6983 |
| 156 | Ga0466705_415671 | 3300042612 | Bacteria | 7099 |
| 157 | Ga0466712_146896 | 3300042614 | Bacteria | 7969 |
| 158 | Ga0466718_140337 | 3300042617 | Bacteria | 3002 |
| 159 | Ga0466726_165433 | 3300042619 | Bacteria | 15218 |
| 160 | Ga0466729_144886 | 3300042621 | Bacteria | 4176 |
| 161 | 2227069668 | 2225789003 | Bacteria | 14373 |
| 162 | IMNBL1DRAFT_c0000936 | 3300000062 | Bacteria | 22561 |
| 163 | IMNBL1DRAFT_c0003749 | 3300000062 | Bacteria | 9520 |
| 164 | AustNasuHG_c1018150 | 3300000089 | Bacteria | 2327 |
| 165 | AustNasuHG_c1020907 | 3300000089 | Unclassified | 2125 |
| 166 | JGI24695J34938_10001840 | 3300002450 | Bacteria | 17278 |
| 167 | JGI24695J34938_10057007 | 3300002450 | Bacteria | 1681 |
| 168 | JGI24702J35022_10022121 | 3300002462 | Bacteria | 3445 |
| 169 | JGI24705J35276_12218597 | 3300002504 | Bacteria | 2154 |
| 170 | Ga0072940_1006822 | 3300005200 | Bacteria | 11148 |
| 171 | Ga0072941_1018651 | 3300005201 | Bacteria | 10882 |
| 172 | Ga0123357_10009557 | 3300009784 | Bacteria | 12247 |
| 173 | Ga0123357_10032043 | 3300009784 | Bacteria | 7135 |
| 174 | Ga0123356_10005895 | 3300010049 | Bacteria | 12439 |
| 175 | Ga0123356_10092633 | 3300010049 | Bacteria | 2882 |
| 176 | Ga0123356_10241487 | 3300010049 | Bacteria | 1878 |
| 177 | Ga0123353_10237651 | 3300010167 | Bacteria | 2834 |
| 178 | Ga0123353_10310786 | 3300010167 | Bacteria | 2399 |
| 179 | Ga0123354_10053549 | 3300010882 | Bacteria | 6068 |
| 180 | Ga0123354_10128015 | 3300010882 | Bacteria | 3229 |
| 181 | Ga0466735_069773 | 3300042624 | Bacteria | 2591 |
| 182 | Ga0466703_249270 | 3300042636 | Bacteria | 21168 |
| 183 | Ga0466709_169139 | 3300042648 | Bacteria | 148698 |
| 184 | Ga0466709_177463 | 3300042648 | Bacteria | 1021 |
| 185 | Ga0466709_266783 | 3300042648 | Bacteria | 18569 |
| 186 | Ga0466709_315439 | 3300042648 | Bacteria | 6829 |
| 187 | Ga0466725_410601 | 3300042654 | Bacteria | 12300 |
| 188 | Ga0160441_100216 | 3300012825 | Bacteria | 57462 |
| 189 | Ga0264413_101271 | 3300024493 | Bacteria | 16755 |
| 190 | Ga0265387_1009845 | 3300024582 | Bacteria | 1297 |
| 191 | Ga0466690_083768 | 3300042590 | Bacteria | 25653 |
| 192 | Ga0466690_368199 | 3300042590 | Bacteria | 38594 |
| 193 | Ga0466692_055320 | 3300042591 | Bacteria | 1843 |
| 194 | Ga0466694_118476 | 3300042594 | Bacteria | 3063 |
| 195 | Ga0466694_342870 | 3300042594 | Bacteria | 24514 |
| 196 | Ga0466694_359432 | 3300042594 | Bacteria | 7628 |
| 197 | Ga0466696_346416 | 3300042596 | Bacteria | 19925 |
| 198 | Ga0466696_394357 | 3300042596 | Bacteria | 1798 |
| 199 | Ga0466699_024775 | 3300042597 | Bacteria | 1590 |
| 200 | Ga0466707_326453 | 3300042601 | Bacteria | 4670 |
| 201 | Ga0466707_385268 | 3300042601 | Bacteria | 1939 |
| 202 | Ga0466713_094780 | 3300042602 | Bacteria | 5332 |
| 203 | Ga0466714_028666 | 3300042603 | Bacteria | 89946 |
| 204 | Ga0466716_302221 | 3300042605 | Bacteria | 3603 |
| 205 | Ga0466716_448041 | 3300042605 | Bacteria | 4791 |
| 206 | Ga0466719_027708 | 3300042606 | Bacteria | 1260 |
| 207 | Ga0466698_266594 | 3300042610 | Bacteria | 1430 |
| 208 | Ga0466698_277808 | 3300042610 | Bacteria | 2276 |
| 209 | Ga0466697_101400 | 3300042611 | Bacteria | 1790 |
| 210 | Ga0466705_239820 | 3300042612 | Bacteria | 10601 |
| 211 | Ga0466732_015758 | 3300042656 | Bacteria | 3860 |
| 212 | Ga0466711_365017 | 3300042615 | Bacteria | 4800 |
| 213 | Ga0466711_373737 | 3300042615 | Bacteria | 78112 |
| 214 | Ga0466715_236444 | 3300042616 | Bacteria | 6618 |
| 215 | Ga0466718_006190 | 3300042617 | Bacteria | 7959 |
| 216 | Ga0466718_161006 | 3300042617 | Bacteria | 1282 |
| 217 | Ga0466728_286887 | 3300042620 | Bacteria | 10655 |
| 218 | 2227209707 | 2225789004 | Unclassified | 1417 |
| 219 | 2227236340 | 2225789004 | Bacteria | 7303 |
| 220 | IMNBGM34_c005625 | 3300000036 | Bacteria | 1650 |
| 221 | JGI24698J34947_10002821 | 3300002449 | Bacteria | 9419 |
| 222 | JGI24699J35502_11128391 | 3300002509 | Bacteria | 4400 |
| 223 | Ga0068302_10031740 | 3300005071 | Bacteria | 4999 |
| 224 | Ga0072941_1018638 | 3300005201 | Bacteria | 40087 |
| 225 | Ga0123357_10000572 | 3300009784 | Bacteria | 36340 |
| 226 | Ga0123357_10029772 | 3300009784 | Bacteria | 7401 |
| 227 | Ga0123357_10207886 | 3300009784 | Bacteria | 2208 |
| 228 | Ga0123356_10095277 | 3300010049 | Bacteria | 2845 |
| 229 | Ga0123354_10002122 | 3300010882 | Bacteria | 25659 |
| 230 | Ga0466734_015842 | 3300042623 | Bacteria | 1169 |
| 231 | Ga0466735_000526 | 3300042624 | Bacteria | 2706 |
| 232 | Ga0466735_066682 | 3300042624 | Bacteria | 5506 |
| 233 | Ga0466735_079339 | 3300042624 | Bacteria | 2763 |
| 234 | Ga0466735_110643 | 3300042624 | Bacteria | 1598 |
| 235 | Ga0466702_220689 | 3300042635 | Bacteria | 1895 |
| 236 | Ga0466703_328965 | 3300042636 | Bacteria | 16920 |
| 237 | Ga0466703_424305 | 3300042636 | Bacteria | 3664 |
| 238 | Ga0466704_552202 | 3300042643 | Bacteria | 23361 |
| 239 | Ga0466709_316667 | 3300042648 | Bacteria | 8932 |
| 240 | Ga0466708_074706 | 3300042652 | Unclassified | 5093 |
| 241 | Ga0466727_030490 | 3300042655 | Bacteria | 13925 |
| 242 | Ga0466727_154212 | 3300042655 | Bacteria | 9784 |
| 243 | Ga0466690_386545 | 3300042590 | Bacteria | 6771 |
| 244 | Ga0466696_018170 | 3300042596 | Bacteria | 9282 |
| 245 | Ga0466696_033055 | 3300042596 | Bacteria | 18048 |
| 246 | Ga0466696_295642 | 3300042596 | Bacteria | 9835 |
| 247 | Ga0466701_046312 | 3300042598 | Bacteria | 1132 |
| 248 | Ga0466701_050909 | 3300042598 | Bacteria | 1166 |
| 249 | Ga0466706_007092 | 3300042599 | Bacteria | 17739 |
| 250 | Ga0466706_020456 | 3300042599 | Bacteria | 8818 |
| 251 | Ga0466706_087294 | 3300042599 | Bacteria | 15249 |
| 252 | Ga0466707_288439 | 3300042601 | Bacteria | 1779 |
| 253 | Ga0466713_014583 | 3300042602 | Bacteria | 29300 |
| 254 | Ga0466713_058673 | 3300042602 | Bacteria | 88401 |
| 255 | Ga0466714_082006 | 3300042603 | Bacteria | 191145 |
| 256 | Ga0466714_128106 | 3300042603 | Bacteria | 1103 |
| 257 | Ga0466719_139427 | 3300042606 | Bacteria | 18554 |
| 258 | Ga0466720_153997 | 3300042607 | Bacteria | 17039 |
| 259 | Ga0466721_050161 | 3300042608 | Bacteria | 15568 |
| 260 | Ga0466698_296392 | 3300042610 | Bacteria | 1633 |
| 261 | Ga0466697_258576 | 3300042611 | Bacteria | 357278 |
| 262 | Ga0466705_132816 | 3300042612 | Bacteria | 2516 |
| 263 | Ga0466705_179010 | 3300042612 | Bacteria | 13746 |
| 264 | Ga0466705_263894 | 3300042612 | Bacteria | 6780 |
| 265 | Ga0466705_303009 | 3300042612 | Bacteria | 13305 |
| 266 | Ga0466733_078470 | 3300042659 | Bacteria | 5647 |
| 267 | Ga0466733_179584 | 3300042659 | Bacteria | 84251 |
| 268 | Ga0466733_181941 | 3300042659 | Bacteria | 3577 |
| 269 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 270 | Ga0466712_120056 | 3300042614 | Bacteria | 11015 |
| 271 | Ga0466711_163822 | 3300042615 | Bacteria | 10301 |
| 272 | Ga0466711_242214 | 3300042615 | Bacteria | 21583 |
| 273 | Ga0466726_257399 | 3300042619 | Unclassified | 12159 |
| 274 | Ga0466726_453393 | 3300042619 | Bacteria | 2888 |
| 275 | 2227097468 | 2225789004 | Bacteria | 9705 |
| 276 | 2227465750 | 2225789004 | Bacteria | 5169 |
| 277 | IMNBL1DRAFT_c0000563 | 3300000062 | Bacteria | 29996 |
| 278 | IMNBL1DRAFT_c0037524 | 3300000062 | Bacteria | 1678 |
| 279 | AustNasuHG_c1003111 | 3300000089 | Bacteria | 5986 |
| 280 | AustNasuHG_c1008168 | 3300000089 | Bacteria | 3712 |
| 281 | AustNasuHG_c1030243 | 3300000089 | Unclassified | 1563 |
| 282 | FAAS_10008810 | 3300001880 | Bacteria | 1083 |
| 283 | Ga0068302_10045277 | 3300005071 | Bacteria | 6769 |
| 284 | Ga0068305_10057928 | 3300005083 | Bacteria | 12146 |
| 285 | Ga0072941_1143095 | 3300005201 | Bacteria | 1282 |
| 286 | Ga0074263_105599 | 3300005485 | Bacteria | 1476 |
| 287 | Ga0123357_10188816 | 3300009784 | Bacteria | 2382 |
| 288 | Ga0123356_10113251 | 3300010049 | Bacteria | 2624 |
| 289 | Ga0123356_10261500 | 3300010049 | Bacteria | 1815 |
| 290 | Ga0466729_258752 | 3300042621 | Bacteria | 1455 |
| 291 | Ga0466729_271958 | 3300042621 | Bacteria | 37013 |
| 292 | Ga0466729_298838 | 3300042621 | Bacteria | 9069 |
| 293 | Ga0466735_214004 | 3300042624 | Bacteria | 3431 |
| 294 | Ga0466703_083927 | 3300042636 | Bacteria | 22876 |
| 295 | Ga0466703_092740 | 3300042636 | Bacteria | 2588 |
| 296 | Ga0466704_106067 | 3300042643 | Bacteria | 5749 |
| 297 | Ga0466704_512196 | 3300042643 | Bacteria | 2324 |
| 298 | Ga0466724_39324 | 3300042649 | Bacteria | 3125 |
| 299 | Ga0466708_024822 | 3300042652 | Bacteria | 3008 |
| 300 | Ga0466708_128256 | 3300042652 | Bacteria | 26178 |
| 301 | Ga0466708_348735 | 3300042652 | Bacteria | 36830 |
| 302 | Ga0160435_1000060 | 3300012857 | Bacteria | 75750 |
| 303 | Ga0264413_101232 | 3300024493 | Bacteria | 26183 |
| 304 | Ga0264413_107547 | 3300024493 | Bacteria | 10499 |
| 305 | Ga0466656_267176 | 3300042550 | Bacteria | 8551 |
| 306 | Ga0466690_209198 | 3300042590 | Unclassified | 15710 |
| 307 | Ga0466694_020569 | 3300042594 | Bacteria | 6672 |
| 308 | Ga0466694_200500 | 3300042594 | Bacteria | 14231 |
| 309 | Ga0466696_235855 | 3300042596 | Bacteria | 10581 |
| 310 | Ga0466706_239807 | 3300042599 | Bacteria | 2197 |
| 311 | Ga0466707_096168 | 3300042601 | Bacteria | 11351 |
| 312 | Ga0466707_371061 | 3300042601 | Bacteria | 5489 |
| 313 | Ga0466713_037411 | 3300042602 | Bacteria | 14139 |
| 314 | Ga0466713_070338 | 3300042602 | Bacteria | 49717 |
| 315 | Ga0466713_137064 | 3300042602 | Bacteria | 16956 |
| 316 | Ga0466714_153181 | 3300042603 | Bacteria | 120481 |
| 317 | Ga0466719_522466 | 3300042606 | Bacteria | 12904 |
| 318 | Ga0466720_037497 | 3300042607 | Bacteria | 23475 |
| 319 | Ga0466722_037973 | 3300042609 | Bacteria | 1247 |
| 320 | Ga0466722_155549 | 3300042609 | Bacteria | 11886 |
| 321 | Ga0466697_170550 | 3300042611 | Bacteria | 1421 |
| 322 | Ga0466733_221141 | 3300042659 | Bacteria | 323281 |
| 323 | Ga0466711_077353 | 3300042615 | Bacteria | 5346 |
| 324 | Ga0466711_360436 | 3300042615 | Bacteria | 1824 |
| 325 | Ga0466718_011473 | 3300042617 | Bacteria | 5236 |
| 326 | Ga0466726_335539 | 3300042619 | Bacteria | 1443 |
| 327 | Ga0466729_108976 | 3300042621 | Bacteria | 26843 |
| 328 | 2227086100 | 2225789004 | Bacteria | 1855 |
| 329 | 2227228020 | 2225789004 | Bacteria | 7398 |
| 330 | IMNBL1DRAFT_c0001879 | 3300000062 | Bacteria | 15291 |
| 331 | AustNasuHG_c1002111 | 3300000089 | Bacteria | 7182 |
| 332 | AustNasuHG_c1008125 | 3300000089 | Bacteria | 3721 |
| 333 | JGI24698J34947_10005584 | 3300002449 | Bacteria | 6901 |
| 334 | Ga0068305_10006001 | 3300005083 | Bacteria | 46260 |
| 335 | Ga0072941_1010134 | 3300005201 | Bacteria | 8733 |
| 336 | Ga0123357_10010391 | 3300009784 | Bacteria | 11836 |
| 337 | Ga0123356_10008869 | 3300010049 | Bacteria | 9954 |
| 338 | Ga0123356_10225515 | 3300010049 | Bacteria | 1934 |
| 339 | Ga0123354_10111562 | 3300010882 | Bacteria | 3607 |
| 340 | Ga0466729_262303 | 3300042621 | Bacteria | 1767 |
| 341 | Ga0466735_012596 | 3300042624 | Bacteria | 7500 |
| 342 | Ga0466735_037005 | 3300042624 | Bacteria | 1729 |
| 343 | Ga0466703_268796 | 3300042636 | Bacteria | 1751 |
| 344 | Ga0466704_027583 | 3300042643 | Bacteria | 6500 |
| 345 | Ga0466704_300754 | 3300042643 | Bacteria | 15840 |
| 346 | Ga0466725_237223 | 3300042654 | Bacteria | 2331 |
| 347 | Ga0466727_121999 | 3300042655 | Bacteria | 5144 |
| 348 | Ga0466727_124807 | 3300042655 | Bacteria | 5169 |
| 349 | Ga0466727_304649 | 3300042655 | Bacteria | 3914 |
| 350 | Ga0160472_102534 | 3300012839 | Bacteria | 4064 |
| 351 | Ga0466690_082361 | 3300042590 | Bacteria | 23926 |
| 352 | Ga0466690_158849 | 3300042590 | Bacteria | 3700 |
| 353 | Ga0466691_020068 | 3300042593 | Bacteria | 8367 |
| 354 | Ga0466691_198630 | 3300042593 | Bacteria | 9353 |
| 355 | Ga0466701_069807 | 3300042598 | Bacteria | 4604 |
| 356 | Ga0466706_023300 | 3300042599 | Bacteria | 3792 |
| 357 | Ga0466706_192938 | 3300042599 | Bacteria | 3876 |
| 358 | Ga0466700_112686 | 3300042600 | Bacteria | 21617 |
| 359 | Ga0466707_115499 | 3300042601 | Bacteria | 14029 |
| 360 | Ga0466707_241108 | 3300042601 | Bacteria | 10272 |
| 361 | Ga0466713_046110 | 3300042602 | Bacteria | 12828 |
| 362 | Ga0466713_065655 | 3300042602 | Bacteria | 3100 |
| 363 | Ga0466713_072522 | 3300042602 | Bacteria | 16632 |
| 364 | Ga0466714_169841 | 3300042603 | Bacteria | 65934 |
| 365 | Ga0466716_283586 | 3300042605 | Bacteria | 36250 |
| 366 | Ga0466720_133130 | 3300042607 | Bacteria | 35831 |
| 367 | Ga0466722_163169 | 3300042609 | Bacteria | 19178 |
| 368 | Ga0466705_043836 | 3300042612 | Bacteria | 11701 |
| 369 | Ga0466705_127217 | 3300042612 | Bacteria | 28425 |
| 370 | Ga0466712_269733 | 3300042614 | Bacteria | 1615 |
| 371 | Ga0466711_048481 | 3300042615 | Unclassified | 1381 |
| 372 | Ga0466715_117755 | 3300042616 | Bacteria | 4378 |
| 373 | Ga0466715_303208 | 3300042616 | Bacteria | 19718 |
| 374 | Ga0466715_376988 | 3300042616 | Bacteria | 36049 |
| 375 | Ga0466723_097479 | 3300042618 | Bacteria | 24080 |
| 376 | Ga0466726_197801 | 3300042619 | Bacteria | 4074 |
| 377 | Ga0466728_141584 | 3300042620 | Bacteria | 11233 |
| 378 | IMNBL1DRAFT_c0003109 | 3300000062 | Bacteria | 10946 |
| 379 | JGI24695J34938_10006892 | 3300002450 | Bacteria | 6745 |
| 380 | JGI24702J35022_10005790 | 3300002462 | Bacteria | 7203 |
| 381 | JGI24702J35022_10083238 | 3300002462 | Bacteria | 1735 |
| 382 | JGI24705J35276_12234362 | 3300002504 | Bacteria | 5455 |
| 383 | JGI24699J35502_11134138 | 3300002509 | Bacteria | 36202 |
| 384 | Ga0068305_10084879 | 3300005083 | Bacteria | 22669 |
| 385 | Ga0123357_10042032 | 3300009784 | Bacteria | 6217 |
| 386 | Ga0123356_10839448 | 3300010049 | Bacteria | 1090 |
| 387 | Ga0123353_10274064 | 3300010167 | Bacteria | 2597 |
| 388 | Ga0123353_10288806 | 3300010167 | Unclassified | 2512 |
| 389 | Ga0123354_10010405 | 3300010882 | Bacteria | 14326 |
| 390 | Ga0123354_10081015 | 3300010882 | Bacteria | 4590 |
| 391 | Ga0160464_100078 | 3300012805 | Bacteria | 114961 |
| 392 | Ga0466731_429911 | 3300042622 | Bacteria | 1247 |
| 393 | Ga0466735_067218 | 3300042624 | Bacteria | 3995 |
| 394 | Ga0466702_011274 | 3300042635 | Bacteria | 2110 |
| 395 | Ga0466704_341214 | 3300042643 | Bacteria | 10492 |
| 396 | Ga0466709_330757 | 3300042648 | Bacteria | 15272 |
| 397 | Ga0466725_255403 | 3300042654 | Bacteria | 1272 |
| 398 | Ga0466727_302157 | 3300042655 | Bacteria | 4147 |
| 399 | Ga0265387_1002001 | 3300024582 | Bacteria | 2907 |
| 400 | Ga0466657_108987 | 3300042582 | Bacteria | 8844 |
| 401 | Ga0466690_123167 | 3300042590 | Bacteria | 11048 |
| 402 | Ga0466690_339584 | 3300042590 | Bacteria | 3107 |
| 403 | Ga0466694_036427 | 3300042594 | Bacteria | 6025 |
| 404 | Ga0466694_149164 | 3300042594 | Bacteria | 23932 |
| 405 | Ga0466696_305174 | 3300042596 | Bacteria | 17650 |
| 406 | Ga0466706_059970 | 3300042599 | Bacteria | 23340 |
| 407 | Ga0466713_050541 | 3300042602 | Bacteria | 67434 |
| 408 | Ga0466713_115886 | 3300042602 | Bacteria | 8508 |
| 409 | Ga0466713_120182 | 3300042602 | Bacteria | 54854 |
| 410 | Ga0466714_121808 | 3300042603 | Bacteria | 1107 |
| 411 | Ga0466716_386438 | 3300042605 | Bacteria | 23382 |
| 412 | Ga0466716_513141 | 3300042605 | Bacteria | 17413 |
| 413 | Ga0466719_143543 | 3300042606 | Bacteria | 2561 |
| 414 | Ga0466719_193480 | 3300042606 | Unclassified | 3939 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01177 | Asp_Glu_race | Asp/Glu/Hydantoin racemase | 56 | 255 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.