Protein Family IF04879

Metagenome Metatranscriptome Isolate
377 Members
132 Samples
313 Scaffolds
294.99 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_080194|Ga0466691_080194_4239_5243
Length
334 aa
Sequence
MGGLLGLQGKKSPCRRFLEVLCAKRSKLRGFRINSIQVEMKMADLDGVKVEKNYYVDTPFATDGDFHVKGAANLDWGMKKHLTNIFNPKSGNTVMFAFDHGYFMGSVSGLERLDILIPRLIDHIDVLMATRGAFKTCVKPNFRKGIALRASAGSSMINDDLSHEIVSVDIEDAIRMNADCLAVQTFIGADGQLQSIDNLSKVINAASRYSIPTLGVIAVGKNMERTDQYFKLATRIVAEIGAHIVKTYYCDKFEEIVAACPVPIVVAGGKKLPEKEALEMAYRSIQGGARGLDMGRNIFQSYHPAEMADAIGKIVHEGFTDKEAWEYYSDKTRR

πŸ“Š Sample Types

Isolate 17.0%
Metagenome 82.8%
MAG 0.0%
Metatranscriptome 0.3%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 31.2%
Termitidae 21.1%
Kalotermitidae 10.9%
Tenebrionidae 4.7%
Calliphoridae 3.1%
Drosophilidae 2.3%
Rhinotermitidae 2.3%
Armadillidiidae 2.3%
Plutellidae 2.3%
Cerambycidae 2.3%
Tephritidae 2.3%
Termopsidae 2.3%
Pentatomidae 1.6%
Culicidae 1.6%
Curculionidae 1.6%
Ceratophyllidae 0.8%
Nephropidae 0.8%
Hodotermitidae 0.8%
Rhopalidae 0.8%
Carabidae 0.8%
Crambidae 0.8%
Passalidae 0.8%
Palinuridae 0.8%
Scarabaeidae 0.8%
Formicidae 0.8%

🌳 Taxonomy

Archaea 1
Bacteria 322
Eukaryota 0
Viruses 0
Unclassified 54

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
2 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
3 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
4 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
5 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
6 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
9 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
15 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
16 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
21 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
22 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
23 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
26 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
27 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
31 3300035362 Midgut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - larva Metagenome Plutellidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
35 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
36 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
37 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
38 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
39 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
40 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
41 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
42 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
43 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
46 8071333649 Escherichia coli PN108 Isolate Calliphoridae
47 8071338694 Escherichia coli PN87 Isolate Calliphoridae
48 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
49 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
50 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
51 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
52 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
53 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
54 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
55 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
56 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
57 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
58 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
59 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
60 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
61 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
62 8071343737 Escherichia coli PN119 Isolate Calliphoridae
63 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
64 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
65 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
66 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
67 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
68 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
69 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
70 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
71 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
72 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
73 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
74 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
75 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
76 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
77 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
78 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
79 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
80 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
81 2978102237 Serratia fonticola AeS1 Isolate Culicidae
82 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
83 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
84 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
85 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
86 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
87 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
88 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
89 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
90 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
91 8018312681 Enterobacter sp. OLF Isolate Tephritidae
92 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
93 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
94 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
95 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
96 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
97 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
98 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
99 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
100 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
101 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
102 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
103 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
104 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
105 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
106 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
107 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
108 8021546568 Klebsiella sp. Kps Isolate Tephritidae
109 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
110 8071322446 Escherichia coli PN122 Isolate Calliphoridae
111 2971189173 Yersinia pestis A-1249 Isolate Unclassified
112 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
113 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
114 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
115 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
116 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
117 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
118 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
119 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
120 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
121 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
122 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
123 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
124 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
125 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
126 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
127 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
128 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
129 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
130 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
131 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
132 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466730_098140 3300042625 Bacteria 14762
2 Ga0466702_350760 3300042635 Bacteria 11855
3 Ga0466703_060122 3300042636 Bacteria 3815
4 Ga0466704_019882 3300042643 Bacteria 23178
5 Ga0466704_221971 3300042643 Bacteria 2967
6 Ga0466708_368565 3300042652 Bacteria 5641
7 Ga0123356_10000042 3300010049 Bacteria 135091
8 Ga0123356_10001400 3300010049 Bacteria 26708
9 Ga0123356_10080393 3300010049 Bacteria 3082
10 Ga0123353_10397796 3300010167 Bacteria 2052
11 Ga0466690_292055 3300042590 Bacteria 3781
12 Ga0466696_384708 3300042596 Bacteria 7459
13 Ga0466701_035995 3300042598 Bacteria 47930
14 Ga0466707_296148 3300042601 Bacteria 2196
15 Ga0466713_007247 3300042602 Bacteria 4482
16 Ga0466713_039544 3300042602 Bacteria 3663
17 Ga0466713_109170 3300042602 Bacteria 14500
18 Ga0466717_253021 3300042604 Bacteria 1024
19 Ga0466719_329681 3300042606 Bacteria 1741
20 Ga0466720_045964 3300042607 Unclassified 7789
21 Ga0466720_168952 3300042607 Bacteria 58654
22 AustNasuHG_c1028427 3300000089 Unclassified 1670
23 JGI24698J34947_10003848 3300002449 Bacteria 8161
24 JGI24698J34947_10028316 3300002449 Bacteria 2966
25 JGI24698J34947_10066264 3300002449 Unclassified 1757
26 JGI24698J34947_10098189 3300002449 Unclassified 1324
27 JGI24695J34938_10000007 3300002450 Bacteria 136740
28 JGI24695J34938_10002138 3300002450 Bacteria 15433
29 JGI24695J34938_10002601 3300002450 Bacteria 13589
30 JGI24695J34938_10004202 3300002450 Bacteria 9575
31 JGI24695J34938_10016135 3300002450 Bacteria 3813
32 JGI24695J34938_10017832 3300002450 Bacteria 3566
33 JGI24695J34938_10025593 3300002450 Unclassified 2818
34 CVPL010L_1000010 3300002932 Bacteria 92684
35 Ga0104042_1120751 3300007130 Bacteria 1966
36 Ga0466732_180689 3300042656 Bacteria 3209
37 Ga0466712_086588 3300042614 Bacteria 1453
38 Ga0466711_458388 3300042615 Bacteria 4742
39 Ga0466715_246965 3300042616 Bacteria 4367
40 Ga0466718_006444 3300042617 Bacteria 75149
41 Ga0466718_012367 3300042617 Bacteria 4961
42 Ga0466718_105081 3300042617 Unclassified 2247
43 Ga0466726_184995 3300042619 Bacteria 12877
44 Ga0466726_331773 3300042619 Bacteria 2980
45 Ga0466726_421544 3300042619 Bacteria 2417
46 Ga0466730_032525 3300042625 Bacteria 82619
47 Ga0466702_352663 3300042635 Bacteria 2552
48 Ga0466709_057066 3300042648 Bacteria 56485
49 Ga0466727_046616 3300042655 Bacteria 2816
50 Ga0123356_10029528 3300010049 Archaea 5134
51 Ga0264413_117744 3300024493 Bacteria 4618
52 Ga0247290_00032 3300035364 Unclassified 52022
53 Ga0466692_116127 3300042591 Bacteria 20676
54 Ga0466691_000364 3300042593 Bacteria 5960
55 Ga0466691_003952 3300042593 Bacteria 20428
56 Ga0466701_021850 3300042598 Bacteria 6589
57 Ga0466707_245625 3300042601 Bacteria 6588
58 Ga0466713_056213 3300042602 Bacteria 5558
59 JGI24698J34947_10012521 3300002449 Unclassified 4649
60 JGI24698J34947_10020181 3300002449 Bacteria 3593
61 JGI24695J34938_10004139 3300002450 Bacteria 9653
62 JGI24695J34938_10004684 3300002450 Bacteria 8868
63 JGI24695J34938_10027434 3300002450 Unclassified 2691
64 Ga0063521_1000039 3300003973 Bacteria 113027
65 Ga0072941_1014341 3300005201 Bacteria 5738
66 Ga0074188_1155868 3300005318 Unclassified 1919
67 Ga0466705_232017 3300042612 Bacteria 6118
68 Ga0466705_244781 3300042612 Bacteria 2135
69 Ga0466733_132274 3300042659 Bacteria 134630
70 Ga0562374_1940 3300057007 Unclassified 21130
71 Ga0466712_322685 3300042614 Bacteria 13346
72 Ga0466715_268147 3300042616 Bacteria 9723
73 Ga0466715_443581 3300042616 Bacteria 11963
74 Ga0466718_062170 3300042617 Unclassified 2444
75 Ga0466723_047750 3300042618 Bacteria 8066
76 Ga0466723_053125 3300042618 Bacteria 1322
77 Ga0466726_198352 3300042619 Bacteria 4061
78 Ga0466726_272845 3300042619 Bacteria 5631
79 Ga0466728_222528 3300042620 Bacteria 13303
80 Ga0466703_279546 3300042636 Bacteria 125874
81 Ga0466708_034785 3300042652 Bacteria 35232
82 Ga0466708_280992 3300042652 Bacteria 22453
83 Ga0466727_261781 3300042655 Bacteria 3317
84 Ga0123356_10162638 3300010049 Bacteria 2232
85 Ga0123353_10000049 3300010167 Bacteria 131325
86 Ga0160444_103616 3300012841 Unclassified 2187
87 Ga0264413_101847 3300024493 Bacteria 86591
88 Ga0466690_050415 3300042590 Bacteria 12913
89 Ga0466690_130476 3300042590 Bacteria 7287
90 Ga0466692_120186 3300042591 Bacteria 1598
91 Ga0466692_136704 3300042591 Bacteria 4420
92 Ga0466694_204367 3300042594 Bacteria 29137
93 Ga0466696_382769 3300042596 Bacteria 3452
94 Ga0466713_126482 3300042602 Bacteria 3051
95 Ga0466716_277485 3300042605 Bacteria 6940
96 Ga0466719_267587 3300042606 Unclassified 1693
97 Ga0466720_120444 3300042607 Unclassified 9626
98 Ga0466722_236748 3300042609 Bacteria 5356
99 Ga0466722_253580 3300042609 Bacteria 4274
100 FGTW_contig17328 2065487013 Unclassified 1273
101 FGTW_contig25994 2065487013 Unclassified 52819
102 JGI24698J34947_10002909 3300002449 Bacteria 9286
103 JGI24698J34947_10072533 3300002449 Unclassified 1647
104 JGI24698J34947_10102541 3300002449 Unclassified 1283
105 JGI24695J34938_10000063 3300002450 Bacteria 87942
106 JGI24695J34938_10000178 3300002450 Bacteria 59181
107 JGI24695J34938_10001170 3300002450 Bacteria 23318
108 JGI24695J34938_10004576 3300002450 Unclassified 9012
109 Ga0072941_1015170 3300005201 Bacteria 32856
110 Ga0466705_102894 3300042612 Bacteria 2170
111 Ga0562375_0076 3300056856 Bacteria 327447
112 Ga0562375_0263 3300056856 Bacteria 137125
113 Ga0562374_2928 3300057007 Bacteria 12132
114 Ga0466712_045823 3300042614 Unclassified 4662
115 Ga0466712_052352 3300042614 Unclassified 1484
116 Ga0466712_127270 3300042614 Bacteria 17968
117 Ga0466711_249608 3300042615 Bacteria 11268
118 Ga0466715_032096 3300042616 Bacteria 30753
119 Ga0466715_104840 3300042616 Bacteria 52795
120 Ga0466715_304445 3300042616 Unclassified 10389
121 Ga0466718_009303 3300042617 Bacteria 10807
122 Ga0466718_106710 3300042617 Bacteria 2867
123 Ga0466718_135958 3300042617 Bacteria 6510
124 Ga0466726_152218 3300042619 Bacteria 6639
125 Ga0466731_046949 3300042622 Bacteria 4758
126 Ga0466730_003553 3300042625 Bacteria 13168
127 Ga0466703_071094 3300042636 Bacteria 12043
128 Ga0466708_059166 3300042652 Bacteria 7235
129 Ga0123356_10001164 3300010049 Bacteria 29125
130 Ga0123353_10002487 3300010167 Bacteria 22942
131 Ga0247290_00109 3300035364 Unclassified 25456
132 Ga0466657_164647 3300042582 Bacteria 8494
133 Ga0466691_080194 3300042593 Bacteria 5959
134 Ga0466699_062508 3300042597 Unclassified 3773
135 Ga0466706_146632 3300042599 Bacteria 1635
136 Ga0466713_025590 3300042602 Bacteria 2010
137 Ga0466714_097704 3300042603 Bacteria 1853
138 Ga0466716_207710 3300042605 Bacteria 35454
139 Ga0466719_142127 3300042606 Bacteria 1100
140 AustNasuHG_c1000319 3300000089 Bacteria 16758
141 AustNasuHG_c1023955 3300000089 Bacteria 1941
142 JGI24698J34947_10077071 3300002449 Unclassified 1578
143 JGI24698J34947_10099717 3300002449 Bacteria 1309
144 JGI24698J34947_10130937 3300002449 Unclassified 1072
145 JGI24695J34938_10000161 3300002450 Bacteria 62308
146 JGI24695J34938_10001479 3300002450 Bacteria 19851
147 JGI24695J34938_10045627 3300002450 Unclassified 1943
148 Ga0063521_1000391 3300003973 Bacteria 24291
149 Ga0466705_004430 3300042612 Bacteria 6338
150 Ga0466705_131574 3300042612 Bacteria 44167
151 Ga0466733_170704 3300042659 Bacteria 1226
152 Ga0466712_139157 3300042614 Bacteria 70891
153 Ga0466712_203628 3300042614 Unclassified 2038
154 Ga0466718_167406 3300042617 Bacteria 5983
155 Ga0466723_099985 3300042618 Bacteria 5656
156 Ga0466723_104565 3300042618 Unclassified 2016
157 Ga0466726_330920 3300042619 Bacteria 2593
158 Ga0466726_432080 3300042619 Bacteria 1285
159 Ga0466729_052559 3300042621 Bacteria 6088
160 Ga0466729_261430 3300042621 Bacteria 26177
161 Ga0466735_100369 3300042624 Bacteria 1803
162 Ga0466735_199454 3300042624 Bacteria 6899
163 Ga0466702_405298 3300042635 Unclassified 1076
164 Ga0466704_358770 3300042643 Bacteria 2796
165 Ga0466704_427851 3300042643 Bacteria 5416
166 Ga0466727_166665 3300042655 Bacteria 15729
167 Ga0123356_10000007 3300010049 Bacteria 240704
168 Ga0123356_10004159 3300010049 Bacteria 15019
169 Ga0123356_10122884 3300010049 Bacteria 2529
170 Ga0264413_114728 3300024493 Bacteria 6049
171 Ga0264413_123962 3300024493 Bacteria 3485
172 Ga0247290_00214 3300035364 Unclassified 16811
173 Ga0466690_103893 3300042590 Bacteria 3641
174 Ga0466690_236542 3300042590 Bacteria 5900
175 Ga0466693_075896 3300042592 Bacteria 53125
176 Ga0466691_099515 3300042593 Bacteria 2199
177 Ga0466694_069101 3300042594 Bacteria 1872
178 Ga0466695_117520 3300042595 Bacteria 1078
179 Ga0466699_118162 3300042597 Bacteria 2965
180 Ga0466720_147098 3300042607 Bacteria 2655
181 IMNBL1DRAFT_c0000642 3300000062 Bacteria 27994
182 AustNasuHG_c1004774 3300000089 Bacteria 4852
183 JGI24698J34947_10022164 3300002449 Bacteria 3409
184 JGI24698J34947_10053314 3300002449 Unclassified 2025
185 JGI24695J34938_10000292 3300002450 Bacteria 49540
186 JGI24705J35276_12165650 3300002504 Bacteria 1259
187 Ga0072941_1006433 3300005201 Bacteria 11842
188 Ga0072941_1022120 3300005201 Bacteria 30539
189 Ga0072941_1062550 3300005201 Bacteria 1510
190 Ga0074263_103422 3300005485 Unclassified 2690
191 Ga0466733_082577 3300042659 Bacteria 7749
192 Ga0466733_104182 3300042659 Bacteria 1053
193 Ga0466712_047384 3300042614 Unclassified 1934
194 Ga0466712_053514 3300042614 Bacteria 10144
195 Ga0466711_103169 3300042615 Bacteria 7271
196 Ga0466711_347466 3300042615 Bacteria 7122
197 Ga0466718_106711 3300042617 Bacteria 4763
198 Ga0466723_330312 3300042618 Bacteria 1079
199 Ga0466726_014032 3300042619 Bacteria 12743
200 Ga0466726_096088 3300042619 Bacteria 1836
201 Ga0466728_021453 3300042620 Bacteria 3416
202 Ga0466735_223510 3300042624 Bacteria 3576
203 Ga0466730_029767 3300042625 Bacteria 1645
204 Ga0466724_34432 3300042649 Unclassified 57953
205 Ga0123356_10000239 3300010049 Bacteria 63302
206 Ga0123356_10035441 3300010049 Bacteria 4662
207 Ga0123353_10097506 3300010167 Bacteria 4738
208 Ga0123353_10765262 3300010167 Bacteria 1341
209 Ga0264413_103040 3300024493 Bacteria 44618
210 Ga0247290_00086 3300035364 Unclassified 30129
211 Ga0415639_083977 3300038395 Unclassified 4628
212 Ga0415639_230980 3300038395 Bacteria 2173
213 Ga0466694_043087 3300042594 Bacteria 19945
214 Ga0466695_188911 3300042595 Bacteria 64865
215 Ga0466696_204756 3300042596 Bacteria 10800
216 Ga0466696_432646 3300042596 Bacteria 1314
217 Ga0466699_271903 3300042597 Bacteria 3340
218 Ga0466707_179163 3300042601 Bacteria 2190
219 Ga0466707_282182 3300042601 Bacteria 1956
220 Ga0466713_151633 3300042602 Bacteria 10085
221 Ga0466720_056009 3300042607 Bacteria 7931
222 Ga0466720_058043 3300042607 Bacteria 20086
223 Ga0466720_124792 3300042607 Bacteria 21794
224 Ga0466722_007094 3300042609 Bacteria 6876
225 Ga0466722_168877 3300042609 Bacteria 5358
226 JGI24695J34938_10002296 3300002450 Bacteria 14738
227 JGI24695J34938_10008818 3300002450 Bacteria 5706
228 JGI24695J34938_10024298 3300002450 Bacteria 2911
229 Ga0063521_1000003 3300003973 Bacteria 326101
230 Ga0074188_1000220 3300005318 Bacteria 34540
231 Ga0466705_311004 3300042612 Bacteria 3751
232 Ga0466732_399151 3300042656 Bacteria 7107
233 Ga0466712_047554 3300042614 Unclassified 4359
234 Ga0466712_118904 3300042614 Bacteria 5915
235 Ga0466712_296295 3300042614 Unclassified 1341
236 Ga0466711_091961 3300042615 Bacteria 2974
237 Ga0466711_112136 3300042615 Bacteria 1784
238 Ga0466718_127291 3300042617 Unclassified 1895
239 Ga0466723_195229 3300042618 Unclassified 2723
240 Ga0466730_024159 3300042625 Unclassified 46360
241 Ga0466703_162524 3300042636 Bacteria 4701
242 Ga0466703_173099 3300042636 Bacteria 15152
243 Ga0466703_188879 3300042636 Bacteria 76658
244 Ga0466709_143484 3300042648 Bacteria 162355
245 Ga0466724_15893 3300042649 Bacteria 69770
246 Ga0466727_094488 3300042655 Bacteria 2361
247 Ga0466727_164534 3300042655 Bacteria 21910
248 Ga0466727_180245 3300042655 Bacteria 3733
249 Ga0123356_10033053 3300010049 Bacteria 4838
250 Ga0160433_101143 3300012846 Bacteria 8017
251 Ga0223677_1016113 3300021239 Unclassified 1345
252 Ga0247288_00785 3300035362 Bacteria 2540
253 Ga0247289_0019 3300035363 Unclassified 53750
254 Ga0466690_053199 3300042590 Bacteria 4367
255 Ga0466690_062952 3300042590 Bacteria 6987
256 Ga0466713_003276 3300042602 Unclassified 62671
257 Ga0466713_107907 3300042602 Unclassified 7280
258 Ga0466719_261154 3300042606 Bacteria 11097
259 Ga0466720_205791 3300042607 Bacteria 4393
260 Ga0466698_407172 3300042610 Bacteria 1085
261 AustNasuHG_c1000049 3300000089 Bacteria 30482
262 AustNasuHG_c1007910 3300000089 Bacteria 3769
263 JGI24698J34947_10001067 3300002449 Bacteria 14096
264 JGI24698J34947_10007557 3300002449 Bacteria 5971
265 JGI24695J34938_10000006 3300002450 Bacteria 141807
266 JGI24695J34938_10000301 3300002450 Bacteria 48723
267 JGI24695J34938_10002142 3300002450 Bacteria 15418
268 JGI24695J34938_10055534 3300002450 Bacteria 1711
269 CVPL010L_1000873 3300002932 Unclassified 5180
270 Ga0063521_1000145 3300003973 Bacteria 53435
271 Ga0063521_1016339 3300003973 Unclassified 1793
272 Ga0466712_022788 3300042614 Bacteria 19223
273 Ga0466712_095475 3300042614 Bacteria 34280
274 Ga0466712_097048 3300042614 Unclassified 2823
275 Ga0466712_123162 3300042614 Bacteria 17754
276 Ga0466712_226564 3300042614 Bacteria 10213
277 Ga0466711_125290 3300042615 Bacteria 4224
278 Ga0466711_313734 3300042615 Bacteria 1525
279 Ga0466726_308024 3300042619 Bacteria 2900
280 Ga0466730_023540 3300042625 Unclassified 5634
281 Ga0466703_013427 3300042636 Bacteria 5595
282 Ga0466703_305067 3300042636 Bacteria 1480
283 Ga0466704_220028 3300042643 Unclassified 1454
284 Ga0466704_621135 3300042643 Bacteria 3272
285 Ga0466708_049703 3300042652 Bacteria 7035
286 Ga0466708_157234 3300042652 Bacteria 1522
287 Ga0466727_071500 3300042655 Bacteria 6847
288 Ga0160467_100077 3300012829 Bacteria 147457
289 Ga0466690_123191 3300042590 Bacteria 3262
290 Ga0466690_239997 3300042590 Bacteria 1381
291 Ga0466693_186663 3300042592 Bacteria 8955
292 Ga0466694_060894 3300042594 Bacteria 11090
293 Ga0466707_052531 3300042601 Bacteria 1693
294 Ga0466707_141567 3300042601 Bacteria 14707
295 Ga0466713_008347 3300042602 Bacteria 126123
296 Ga0466713_094003 3300042602 Bacteria 21513
297 Ga0466713_117968 3300042602 Bacteria 408806
298 Ga0466714_016599 3300042603 Bacteria 39610
299 Ga0466719_018889 3300042606 Bacteria 10201
300 Ga0466719_293885 3300042606 Bacteria 7388
301 Ga0466720_134230 3300042607 Unclassified 3252
302 Ga0466722_248263 3300042609 Bacteria 1973
303 FGTW_contig06380 2065487013 Bacteria 8618
304 JGI24698J34947_10000064 3300002449 Bacteria 33131
305 Ga0068305_10024824 3300005083 Bacteria 14460
306 Ga0072940_1001052 3300005200 Bacteria 7774
307 Ga0074263_105548 3300005485 Unclassified 1433
308 Ga0466712_091980 3300042614 Bacteria 13610
309 Ga0466718_003462 3300042617 Bacteria 7783
310 Ga0466718_033224 3300042617 Bacteria 2068
311 Ga0466726_252272 3300042619 Bacteria 1947
312 Ga0466728_082287 3300042620 Bacteria 4685
313 Ga0466728_349586 3300042620 Bacteria 3201

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01791 DeoC DeoC/LacD family aldolase 94 301 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01791 GO:0016829 lyase activity MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.