Protein Family IF04879
Metagenome
Metatranscriptome
Isolate
377
Members
132
Samples
313
Scaffolds
294.99
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_080194|Ga0466691_080194_4239_5243
- Length
- 334 aa
- Sequence
- MGGLLGLQGKKSPCRRFLEVLCAKRSKLRGFRINSIQVEMKMADLDGVKVEKNYYVDTPFATDGDFHVKGAANLDWGMKKHLTNIFNPKSGNTVMFAFDHGYFMGSVSGLERLDILIPRLIDHIDVLMATRGAFKTCVKPNFRKGIALRASAGSSMINDDLSHEIVSVDIEDAIRMNADCLAVQTFIGADGQLQSIDNLSKVINAASRYSIPTLGVIAVGKNMERTDQYFKLATRIVAEIGAHIVKTYYCDKFEEIVAACPVPIVVAGGKKLPEKEALEMAYRSIQGGARGLDMGRNIFQSYHPAEMADAIGKIVHEGFTDKEAWEYYSDKTRR
Sample Types
Isolate
17.0%
Metagenome
82.8%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
31.2%
Termitidae
21.1%
Kalotermitidae
10.9%
Tenebrionidae
4.7%
Calliphoridae
3.1%
Drosophilidae
2.3%
Rhinotermitidae
2.3%
Armadillidiidae
2.3%
Plutellidae
2.3%
Cerambycidae
2.3%
Tephritidae
2.3%
Termopsidae
2.3%
Pentatomidae
1.6%
Culicidae
1.6%
Curculionidae
1.6%
Ceratophyllidae
0.8%
Nephropidae
0.8%
Hodotermitidae
0.8%
Rhopalidae
0.8%
Carabidae
0.8%
Crambidae
0.8%
Passalidae
0.8%
Palinuridae
0.8%
Scarabaeidae
0.8%
Formicidae
0.8%
Taxonomy
Archaea
1
Bacteria
322
Eukaryota
0
Viruses
0
Unclassified
54
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 2 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 3 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 4 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 5 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 6 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 15 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 16 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 21 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 22 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 31 | 3300035362 | Midgut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - larva | Metagenome | Plutellidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 40 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 41 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 42 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 43 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 46 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 47 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 48 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 49 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 50 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 51 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 52 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 53 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 54 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 55 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 56 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 58 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 59 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 60 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 61 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 62 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 63 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 64 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 65 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 66 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 67 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 68 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 69 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 70 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 71 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 72 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 73 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 74 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 75 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 76 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 77 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 78 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 79 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 80 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 81 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 82 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 83 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 84 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 85 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 86 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 87 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 88 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 89 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 90 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 91 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 92 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 93 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 94 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 95 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 96 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 97 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 98 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 99 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 100 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 101 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 102 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 103 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 104 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 105 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 106 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 107 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 108 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 109 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 110 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 111 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 112 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 113 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 114 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 115 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 116 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 117 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 118 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 119 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 120 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 121 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 122 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 123 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 124 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 125 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 126 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 127 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 128 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 129 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 130 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 131 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 132 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466730_098140 | 3300042625 | Bacteria | 14762 |
| 2 | Ga0466702_350760 | 3300042635 | Bacteria | 11855 |
| 3 | Ga0466703_060122 | 3300042636 | Bacteria | 3815 |
| 4 | Ga0466704_019882 | 3300042643 | Bacteria | 23178 |
| 5 | Ga0466704_221971 | 3300042643 | Bacteria | 2967 |
| 6 | Ga0466708_368565 | 3300042652 | Bacteria | 5641 |
| 7 | Ga0123356_10000042 | 3300010049 | Bacteria | 135091 |
| 8 | Ga0123356_10001400 | 3300010049 | Bacteria | 26708 |
| 9 | Ga0123356_10080393 | 3300010049 | Bacteria | 3082 |
| 10 | Ga0123353_10397796 | 3300010167 | Bacteria | 2052 |
| 11 | Ga0466690_292055 | 3300042590 | Bacteria | 3781 |
| 12 | Ga0466696_384708 | 3300042596 | Bacteria | 7459 |
| 13 | Ga0466701_035995 | 3300042598 | Bacteria | 47930 |
| 14 | Ga0466707_296148 | 3300042601 | Bacteria | 2196 |
| 15 | Ga0466713_007247 | 3300042602 | Bacteria | 4482 |
| 16 | Ga0466713_039544 | 3300042602 | Bacteria | 3663 |
| 17 | Ga0466713_109170 | 3300042602 | Bacteria | 14500 |
| 18 | Ga0466717_253021 | 3300042604 | Bacteria | 1024 |
| 19 | Ga0466719_329681 | 3300042606 | Bacteria | 1741 |
| 20 | Ga0466720_045964 | 3300042607 | Unclassified | 7789 |
| 21 | Ga0466720_168952 | 3300042607 | Bacteria | 58654 |
| 22 | AustNasuHG_c1028427 | 3300000089 | Unclassified | 1670 |
| 23 | JGI24698J34947_10003848 | 3300002449 | Bacteria | 8161 |
| 24 | JGI24698J34947_10028316 | 3300002449 | Bacteria | 2966 |
| 25 | JGI24698J34947_10066264 | 3300002449 | Unclassified | 1757 |
| 26 | JGI24698J34947_10098189 | 3300002449 | Unclassified | 1324 |
| 27 | JGI24695J34938_10000007 | 3300002450 | Bacteria | 136740 |
| 28 | JGI24695J34938_10002138 | 3300002450 | Bacteria | 15433 |
| 29 | JGI24695J34938_10002601 | 3300002450 | Bacteria | 13589 |
| 30 | JGI24695J34938_10004202 | 3300002450 | Bacteria | 9575 |
| 31 | JGI24695J34938_10016135 | 3300002450 | Bacteria | 3813 |
| 32 | JGI24695J34938_10017832 | 3300002450 | Bacteria | 3566 |
| 33 | JGI24695J34938_10025593 | 3300002450 | Unclassified | 2818 |
| 34 | CVPL010L_1000010 | 3300002932 | Bacteria | 92684 |
| 35 | Ga0104042_1120751 | 3300007130 | Bacteria | 1966 |
| 36 | Ga0466732_180689 | 3300042656 | Bacteria | 3209 |
| 37 | Ga0466712_086588 | 3300042614 | Bacteria | 1453 |
| 38 | Ga0466711_458388 | 3300042615 | Bacteria | 4742 |
| 39 | Ga0466715_246965 | 3300042616 | Bacteria | 4367 |
| 40 | Ga0466718_006444 | 3300042617 | Bacteria | 75149 |
| 41 | Ga0466718_012367 | 3300042617 | Bacteria | 4961 |
| 42 | Ga0466718_105081 | 3300042617 | Unclassified | 2247 |
| 43 | Ga0466726_184995 | 3300042619 | Bacteria | 12877 |
| 44 | Ga0466726_331773 | 3300042619 | Bacteria | 2980 |
| 45 | Ga0466726_421544 | 3300042619 | Bacteria | 2417 |
| 46 | Ga0466730_032525 | 3300042625 | Bacteria | 82619 |
| 47 | Ga0466702_352663 | 3300042635 | Bacteria | 2552 |
| 48 | Ga0466709_057066 | 3300042648 | Bacteria | 56485 |
| 49 | Ga0466727_046616 | 3300042655 | Bacteria | 2816 |
| 50 | Ga0123356_10029528 | 3300010049 | Archaea | 5134 |
| 51 | Ga0264413_117744 | 3300024493 | Bacteria | 4618 |
| 52 | Ga0247290_00032 | 3300035364 | Unclassified | 52022 |
| 53 | Ga0466692_116127 | 3300042591 | Bacteria | 20676 |
| 54 | Ga0466691_000364 | 3300042593 | Bacteria | 5960 |
| 55 | Ga0466691_003952 | 3300042593 | Bacteria | 20428 |
| 56 | Ga0466701_021850 | 3300042598 | Bacteria | 6589 |
| 57 | Ga0466707_245625 | 3300042601 | Bacteria | 6588 |
| 58 | Ga0466713_056213 | 3300042602 | Bacteria | 5558 |
| 59 | JGI24698J34947_10012521 | 3300002449 | Unclassified | 4649 |
| 60 | JGI24698J34947_10020181 | 3300002449 | Bacteria | 3593 |
| 61 | JGI24695J34938_10004139 | 3300002450 | Bacteria | 9653 |
| 62 | JGI24695J34938_10004684 | 3300002450 | Bacteria | 8868 |
| 63 | JGI24695J34938_10027434 | 3300002450 | Unclassified | 2691 |
| 64 | Ga0063521_1000039 | 3300003973 | Bacteria | 113027 |
| 65 | Ga0072941_1014341 | 3300005201 | Bacteria | 5738 |
| 66 | Ga0074188_1155868 | 3300005318 | Unclassified | 1919 |
| 67 | Ga0466705_232017 | 3300042612 | Bacteria | 6118 |
| 68 | Ga0466705_244781 | 3300042612 | Bacteria | 2135 |
| 69 | Ga0466733_132274 | 3300042659 | Bacteria | 134630 |
| 70 | Ga0562374_1940 | 3300057007 | Unclassified | 21130 |
| 71 | Ga0466712_322685 | 3300042614 | Bacteria | 13346 |
| 72 | Ga0466715_268147 | 3300042616 | Bacteria | 9723 |
| 73 | Ga0466715_443581 | 3300042616 | Bacteria | 11963 |
| 74 | Ga0466718_062170 | 3300042617 | Unclassified | 2444 |
| 75 | Ga0466723_047750 | 3300042618 | Bacteria | 8066 |
| 76 | Ga0466723_053125 | 3300042618 | Bacteria | 1322 |
| 77 | Ga0466726_198352 | 3300042619 | Bacteria | 4061 |
| 78 | Ga0466726_272845 | 3300042619 | Bacteria | 5631 |
| 79 | Ga0466728_222528 | 3300042620 | Bacteria | 13303 |
| 80 | Ga0466703_279546 | 3300042636 | Bacteria | 125874 |
| 81 | Ga0466708_034785 | 3300042652 | Bacteria | 35232 |
| 82 | Ga0466708_280992 | 3300042652 | Bacteria | 22453 |
| 83 | Ga0466727_261781 | 3300042655 | Bacteria | 3317 |
| 84 | Ga0123356_10162638 | 3300010049 | Bacteria | 2232 |
| 85 | Ga0123353_10000049 | 3300010167 | Bacteria | 131325 |
| 86 | Ga0160444_103616 | 3300012841 | Unclassified | 2187 |
| 87 | Ga0264413_101847 | 3300024493 | Bacteria | 86591 |
| 88 | Ga0466690_050415 | 3300042590 | Bacteria | 12913 |
| 89 | Ga0466690_130476 | 3300042590 | Bacteria | 7287 |
| 90 | Ga0466692_120186 | 3300042591 | Bacteria | 1598 |
| 91 | Ga0466692_136704 | 3300042591 | Bacteria | 4420 |
| 92 | Ga0466694_204367 | 3300042594 | Bacteria | 29137 |
| 93 | Ga0466696_382769 | 3300042596 | Bacteria | 3452 |
| 94 | Ga0466713_126482 | 3300042602 | Bacteria | 3051 |
| 95 | Ga0466716_277485 | 3300042605 | Bacteria | 6940 |
| 96 | Ga0466719_267587 | 3300042606 | Unclassified | 1693 |
| 97 | Ga0466720_120444 | 3300042607 | Unclassified | 9626 |
| 98 | Ga0466722_236748 | 3300042609 | Bacteria | 5356 |
| 99 | Ga0466722_253580 | 3300042609 | Bacteria | 4274 |
| 100 | FGTW_contig17328 | 2065487013 | Unclassified | 1273 |
| 101 | FGTW_contig25994 | 2065487013 | Unclassified | 52819 |
| 102 | JGI24698J34947_10002909 | 3300002449 | Bacteria | 9286 |
| 103 | JGI24698J34947_10072533 | 3300002449 | Unclassified | 1647 |
| 104 | JGI24698J34947_10102541 | 3300002449 | Unclassified | 1283 |
| 105 | JGI24695J34938_10000063 | 3300002450 | Bacteria | 87942 |
| 106 | JGI24695J34938_10000178 | 3300002450 | Bacteria | 59181 |
| 107 | JGI24695J34938_10001170 | 3300002450 | Bacteria | 23318 |
| 108 | JGI24695J34938_10004576 | 3300002450 | Unclassified | 9012 |
| 109 | Ga0072941_1015170 | 3300005201 | Bacteria | 32856 |
| 110 | Ga0466705_102894 | 3300042612 | Bacteria | 2170 |
| 111 | Ga0562375_0076 | 3300056856 | Bacteria | 327447 |
| 112 | Ga0562375_0263 | 3300056856 | Bacteria | 137125 |
| 113 | Ga0562374_2928 | 3300057007 | Bacteria | 12132 |
| 114 | Ga0466712_045823 | 3300042614 | Unclassified | 4662 |
| 115 | Ga0466712_052352 | 3300042614 | Unclassified | 1484 |
| 116 | Ga0466712_127270 | 3300042614 | Bacteria | 17968 |
| 117 | Ga0466711_249608 | 3300042615 | Bacteria | 11268 |
| 118 | Ga0466715_032096 | 3300042616 | Bacteria | 30753 |
| 119 | Ga0466715_104840 | 3300042616 | Bacteria | 52795 |
| 120 | Ga0466715_304445 | 3300042616 | Unclassified | 10389 |
| 121 | Ga0466718_009303 | 3300042617 | Bacteria | 10807 |
| 122 | Ga0466718_106710 | 3300042617 | Bacteria | 2867 |
| 123 | Ga0466718_135958 | 3300042617 | Bacteria | 6510 |
| 124 | Ga0466726_152218 | 3300042619 | Bacteria | 6639 |
| 125 | Ga0466731_046949 | 3300042622 | Bacteria | 4758 |
| 126 | Ga0466730_003553 | 3300042625 | Bacteria | 13168 |
| 127 | Ga0466703_071094 | 3300042636 | Bacteria | 12043 |
| 128 | Ga0466708_059166 | 3300042652 | Bacteria | 7235 |
| 129 | Ga0123356_10001164 | 3300010049 | Bacteria | 29125 |
| 130 | Ga0123353_10002487 | 3300010167 | Bacteria | 22942 |
| 131 | Ga0247290_00109 | 3300035364 | Unclassified | 25456 |
| 132 | Ga0466657_164647 | 3300042582 | Bacteria | 8494 |
| 133 | Ga0466691_080194 | 3300042593 | Bacteria | 5959 |
| 134 | Ga0466699_062508 | 3300042597 | Unclassified | 3773 |
| 135 | Ga0466706_146632 | 3300042599 | Bacteria | 1635 |
| 136 | Ga0466713_025590 | 3300042602 | Bacteria | 2010 |
| 137 | Ga0466714_097704 | 3300042603 | Bacteria | 1853 |
| 138 | Ga0466716_207710 | 3300042605 | Bacteria | 35454 |
| 139 | Ga0466719_142127 | 3300042606 | Bacteria | 1100 |
| 140 | AustNasuHG_c1000319 | 3300000089 | Bacteria | 16758 |
| 141 | AustNasuHG_c1023955 | 3300000089 | Bacteria | 1941 |
| 142 | JGI24698J34947_10077071 | 3300002449 | Unclassified | 1578 |
| 143 | JGI24698J34947_10099717 | 3300002449 | Bacteria | 1309 |
| 144 | JGI24698J34947_10130937 | 3300002449 | Unclassified | 1072 |
| 145 | JGI24695J34938_10000161 | 3300002450 | Bacteria | 62308 |
| 146 | JGI24695J34938_10001479 | 3300002450 | Bacteria | 19851 |
| 147 | JGI24695J34938_10045627 | 3300002450 | Unclassified | 1943 |
| 148 | Ga0063521_1000391 | 3300003973 | Bacteria | 24291 |
| 149 | Ga0466705_004430 | 3300042612 | Bacteria | 6338 |
| 150 | Ga0466705_131574 | 3300042612 | Bacteria | 44167 |
| 151 | Ga0466733_170704 | 3300042659 | Bacteria | 1226 |
| 152 | Ga0466712_139157 | 3300042614 | Bacteria | 70891 |
| 153 | Ga0466712_203628 | 3300042614 | Unclassified | 2038 |
| 154 | Ga0466718_167406 | 3300042617 | Bacteria | 5983 |
| 155 | Ga0466723_099985 | 3300042618 | Bacteria | 5656 |
| 156 | Ga0466723_104565 | 3300042618 | Unclassified | 2016 |
| 157 | Ga0466726_330920 | 3300042619 | Bacteria | 2593 |
| 158 | Ga0466726_432080 | 3300042619 | Bacteria | 1285 |
| 159 | Ga0466729_052559 | 3300042621 | Bacteria | 6088 |
| 160 | Ga0466729_261430 | 3300042621 | Bacteria | 26177 |
| 161 | Ga0466735_100369 | 3300042624 | Bacteria | 1803 |
| 162 | Ga0466735_199454 | 3300042624 | Bacteria | 6899 |
| 163 | Ga0466702_405298 | 3300042635 | Unclassified | 1076 |
| 164 | Ga0466704_358770 | 3300042643 | Bacteria | 2796 |
| 165 | Ga0466704_427851 | 3300042643 | Bacteria | 5416 |
| 166 | Ga0466727_166665 | 3300042655 | Bacteria | 15729 |
| 167 | Ga0123356_10000007 | 3300010049 | Bacteria | 240704 |
| 168 | Ga0123356_10004159 | 3300010049 | Bacteria | 15019 |
| 169 | Ga0123356_10122884 | 3300010049 | Bacteria | 2529 |
| 170 | Ga0264413_114728 | 3300024493 | Bacteria | 6049 |
| 171 | Ga0264413_123962 | 3300024493 | Bacteria | 3485 |
| 172 | Ga0247290_00214 | 3300035364 | Unclassified | 16811 |
| 173 | Ga0466690_103893 | 3300042590 | Bacteria | 3641 |
| 174 | Ga0466690_236542 | 3300042590 | Bacteria | 5900 |
| 175 | Ga0466693_075896 | 3300042592 | Bacteria | 53125 |
| 176 | Ga0466691_099515 | 3300042593 | Bacteria | 2199 |
| 177 | Ga0466694_069101 | 3300042594 | Bacteria | 1872 |
| 178 | Ga0466695_117520 | 3300042595 | Bacteria | 1078 |
| 179 | Ga0466699_118162 | 3300042597 | Bacteria | 2965 |
| 180 | Ga0466720_147098 | 3300042607 | Bacteria | 2655 |
| 181 | IMNBL1DRAFT_c0000642 | 3300000062 | Bacteria | 27994 |
| 182 | AustNasuHG_c1004774 | 3300000089 | Bacteria | 4852 |
| 183 | JGI24698J34947_10022164 | 3300002449 | Bacteria | 3409 |
| 184 | JGI24698J34947_10053314 | 3300002449 | Unclassified | 2025 |
| 185 | JGI24695J34938_10000292 | 3300002450 | Bacteria | 49540 |
| 186 | JGI24705J35276_12165650 | 3300002504 | Bacteria | 1259 |
| 187 | Ga0072941_1006433 | 3300005201 | Bacteria | 11842 |
| 188 | Ga0072941_1022120 | 3300005201 | Bacteria | 30539 |
| 189 | Ga0072941_1062550 | 3300005201 | Bacteria | 1510 |
| 190 | Ga0074263_103422 | 3300005485 | Unclassified | 2690 |
| 191 | Ga0466733_082577 | 3300042659 | Bacteria | 7749 |
| 192 | Ga0466733_104182 | 3300042659 | Bacteria | 1053 |
| 193 | Ga0466712_047384 | 3300042614 | Unclassified | 1934 |
| 194 | Ga0466712_053514 | 3300042614 | Bacteria | 10144 |
| 195 | Ga0466711_103169 | 3300042615 | Bacteria | 7271 |
| 196 | Ga0466711_347466 | 3300042615 | Bacteria | 7122 |
| 197 | Ga0466718_106711 | 3300042617 | Bacteria | 4763 |
| 198 | Ga0466723_330312 | 3300042618 | Bacteria | 1079 |
| 199 | Ga0466726_014032 | 3300042619 | Bacteria | 12743 |
| 200 | Ga0466726_096088 | 3300042619 | Bacteria | 1836 |
| 201 | Ga0466728_021453 | 3300042620 | Bacteria | 3416 |
| 202 | Ga0466735_223510 | 3300042624 | Bacteria | 3576 |
| 203 | Ga0466730_029767 | 3300042625 | Bacteria | 1645 |
| 204 | Ga0466724_34432 | 3300042649 | Unclassified | 57953 |
| 205 | Ga0123356_10000239 | 3300010049 | Bacteria | 63302 |
| 206 | Ga0123356_10035441 | 3300010049 | Bacteria | 4662 |
| 207 | Ga0123353_10097506 | 3300010167 | Bacteria | 4738 |
| 208 | Ga0123353_10765262 | 3300010167 | Bacteria | 1341 |
| 209 | Ga0264413_103040 | 3300024493 | Bacteria | 44618 |
| 210 | Ga0247290_00086 | 3300035364 | Unclassified | 30129 |
| 211 | Ga0415639_083977 | 3300038395 | Unclassified | 4628 |
| 212 | Ga0415639_230980 | 3300038395 | Bacteria | 2173 |
| 213 | Ga0466694_043087 | 3300042594 | Bacteria | 19945 |
| 214 | Ga0466695_188911 | 3300042595 | Bacteria | 64865 |
| 215 | Ga0466696_204756 | 3300042596 | Bacteria | 10800 |
| 216 | Ga0466696_432646 | 3300042596 | Bacteria | 1314 |
| 217 | Ga0466699_271903 | 3300042597 | Bacteria | 3340 |
| 218 | Ga0466707_179163 | 3300042601 | Bacteria | 2190 |
| 219 | Ga0466707_282182 | 3300042601 | Bacteria | 1956 |
| 220 | Ga0466713_151633 | 3300042602 | Bacteria | 10085 |
| 221 | Ga0466720_056009 | 3300042607 | Bacteria | 7931 |
| 222 | Ga0466720_058043 | 3300042607 | Bacteria | 20086 |
| 223 | Ga0466720_124792 | 3300042607 | Bacteria | 21794 |
| 224 | Ga0466722_007094 | 3300042609 | Bacteria | 6876 |
| 225 | Ga0466722_168877 | 3300042609 | Bacteria | 5358 |
| 226 | JGI24695J34938_10002296 | 3300002450 | Bacteria | 14738 |
| 227 | JGI24695J34938_10008818 | 3300002450 | Bacteria | 5706 |
| 228 | JGI24695J34938_10024298 | 3300002450 | Bacteria | 2911 |
| 229 | Ga0063521_1000003 | 3300003973 | Bacteria | 326101 |
| 230 | Ga0074188_1000220 | 3300005318 | Bacteria | 34540 |
| 231 | Ga0466705_311004 | 3300042612 | Bacteria | 3751 |
| 232 | Ga0466732_399151 | 3300042656 | Bacteria | 7107 |
| 233 | Ga0466712_047554 | 3300042614 | Unclassified | 4359 |
| 234 | Ga0466712_118904 | 3300042614 | Bacteria | 5915 |
| 235 | Ga0466712_296295 | 3300042614 | Unclassified | 1341 |
| 236 | Ga0466711_091961 | 3300042615 | Bacteria | 2974 |
| 237 | Ga0466711_112136 | 3300042615 | Bacteria | 1784 |
| 238 | Ga0466718_127291 | 3300042617 | Unclassified | 1895 |
| 239 | Ga0466723_195229 | 3300042618 | Unclassified | 2723 |
| 240 | Ga0466730_024159 | 3300042625 | Unclassified | 46360 |
| 241 | Ga0466703_162524 | 3300042636 | Bacteria | 4701 |
| 242 | Ga0466703_173099 | 3300042636 | Bacteria | 15152 |
| 243 | Ga0466703_188879 | 3300042636 | Bacteria | 76658 |
| 244 | Ga0466709_143484 | 3300042648 | Bacteria | 162355 |
| 245 | Ga0466724_15893 | 3300042649 | Bacteria | 69770 |
| 246 | Ga0466727_094488 | 3300042655 | Bacteria | 2361 |
| 247 | Ga0466727_164534 | 3300042655 | Bacteria | 21910 |
| 248 | Ga0466727_180245 | 3300042655 | Bacteria | 3733 |
| 249 | Ga0123356_10033053 | 3300010049 | Bacteria | 4838 |
| 250 | Ga0160433_101143 | 3300012846 | Bacteria | 8017 |
| 251 | Ga0223677_1016113 | 3300021239 | Unclassified | 1345 |
| 252 | Ga0247288_00785 | 3300035362 | Bacteria | 2540 |
| 253 | Ga0247289_0019 | 3300035363 | Unclassified | 53750 |
| 254 | Ga0466690_053199 | 3300042590 | Bacteria | 4367 |
| 255 | Ga0466690_062952 | 3300042590 | Bacteria | 6987 |
| 256 | Ga0466713_003276 | 3300042602 | Unclassified | 62671 |
| 257 | Ga0466713_107907 | 3300042602 | Unclassified | 7280 |
| 258 | Ga0466719_261154 | 3300042606 | Bacteria | 11097 |
| 259 | Ga0466720_205791 | 3300042607 | Bacteria | 4393 |
| 260 | Ga0466698_407172 | 3300042610 | Bacteria | 1085 |
| 261 | AustNasuHG_c1000049 | 3300000089 | Bacteria | 30482 |
| 262 | AustNasuHG_c1007910 | 3300000089 | Bacteria | 3769 |
| 263 | JGI24698J34947_10001067 | 3300002449 | Bacteria | 14096 |
| 264 | JGI24698J34947_10007557 | 3300002449 | Bacteria | 5971 |
| 265 | JGI24695J34938_10000006 | 3300002450 | Bacteria | 141807 |
| 266 | JGI24695J34938_10000301 | 3300002450 | Bacteria | 48723 |
| 267 | JGI24695J34938_10002142 | 3300002450 | Bacteria | 15418 |
| 268 | JGI24695J34938_10055534 | 3300002450 | Bacteria | 1711 |
| 269 | CVPL010L_1000873 | 3300002932 | Unclassified | 5180 |
| 270 | Ga0063521_1000145 | 3300003973 | Bacteria | 53435 |
| 271 | Ga0063521_1016339 | 3300003973 | Unclassified | 1793 |
| 272 | Ga0466712_022788 | 3300042614 | Bacteria | 19223 |
| 273 | Ga0466712_095475 | 3300042614 | Bacteria | 34280 |
| 274 | Ga0466712_097048 | 3300042614 | Unclassified | 2823 |
| 275 | Ga0466712_123162 | 3300042614 | Bacteria | 17754 |
| 276 | Ga0466712_226564 | 3300042614 | Bacteria | 10213 |
| 277 | Ga0466711_125290 | 3300042615 | Bacteria | 4224 |
| 278 | Ga0466711_313734 | 3300042615 | Bacteria | 1525 |
| 279 | Ga0466726_308024 | 3300042619 | Bacteria | 2900 |
| 280 | Ga0466730_023540 | 3300042625 | Unclassified | 5634 |
| 281 | Ga0466703_013427 | 3300042636 | Bacteria | 5595 |
| 282 | Ga0466703_305067 | 3300042636 | Bacteria | 1480 |
| 283 | Ga0466704_220028 | 3300042643 | Unclassified | 1454 |
| 284 | Ga0466704_621135 | 3300042643 | Bacteria | 3272 |
| 285 | Ga0466708_049703 | 3300042652 | Bacteria | 7035 |
| 286 | Ga0466708_157234 | 3300042652 | Bacteria | 1522 |
| 287 | Ga0466727_071500 | 3300042655 | Bacteria | 6847 |
| 288 | Ga0160467_100077 | 3300012829 | Bacteria | 147457 |
| 289 | Ga0466690_123191 | 3300042590 | Bacteria | 3262 |
| 290 | Ga0466690_239997 | 3300042590 | Bacteria | 1381 |
| 291 | Ga0466693_186663 | 3300042592 | Bacteria | 8955 |
| 292 | Ga0466694_060894 | 3300042594 | Bacteria | 11090 |
| 293 | Ga0466707_052531 | 3300042601 | Bacteria | 1693 |
| 294 | Ga0466707_141567 | 3300042601 | Bacteria | 14707 |
| 295 | Ga0466713_008347 | 3300042602 | Bacteria | 126123 |
| 296 | Ga0466713_094003 | 3300042602 | Bacteria | 21513 |
| 297 | Ga0466713_117968 | 3300042602 | Bacteria | 408806 |
| 298 | Ga0466714_016599 | 3300042603 | Bacteria | 39610 |
| 299 | Ga0466719_018889 | 3300042606 | Bacteria | 10201 |
| 300 | Ga0466719_293885 | 3300042606 | Bacteria | 7388 |
| 301 | Ga0466720_134230 | 3300042607 | Unclassified | 3252 |
| 302 | Ga0466722_248263 | 3300042609 | Bacteria | 1973 |
| 303 | FGTW_contig06380 | 2065487013 | Bacteria | 8618 |
| 304 | JGI24698J34947_10000064 | 3300002449 | Bacteria | 33131 |
| 305 | Ga0068305_10024824 | 3300005083 | Bacteria | 14460 |
| 306 | Ga0072940_1001052 | 3300005200 | Bacteria | 7774 |
| 307 | Ga0074263_105548 | 3300005485 | Unclassified | 1433 |
| 308 | Ga0466712_091980 | 3300042614 | Bacteria | 13610 |
| 309 | Ga0466718_003462 | 3300042617 | Bacteria | 7783 |
| 310 | Ga0466718_033224 | 3300042617 | Bacteria | 2068 |
| 311 | Ga0466726_252272 | 3300042619 | Bacteria | 1947 |
| 312 | Ga0466728_082287 | 3300042620 | Bacteria | 4685 |
| 313 | Ga0466728_349586 | 3300042620 | Bacteria | 3201 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01791 | DeoC | DeoC/LacD family aldolase | 94 | 301 | 0.88 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01791 | GO:0016829 | lyase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.