Protein Family IF04729
Metagenome
Isolate
366
Members
233
Samples
216
Scaffolds
211.73
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_187374|Ga0466692_187374_1324_2085
- Length
- 253 aa
- Sequence
- VDDVALVLAAWFGSSFEGGRHLERINKVAAAESSGLFTGGPGRVVVFHHPLVRHKMSVLRDKNTGVKEFRELVQEIAGLMLYEITKKLPLSEVQVETPLASVTAHVLKKEPVLVPVLRAGLSMADGMLRFMPNARVGHIGLYRDPVTLDPVEYYCKLPEDIEERDIFVLDPMLATGGSASAAISLVKAKGGRNISLACLIAAPEGIGKIREKHPDTGVFTAALDSGLDGRAYIVPGLGDAGDRLFGTKRLIQQ
Sample Types
Isolate
41.0%
Metagenome
59.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
23.2%
Termitidae
10.9%
Apidae
10.0%
Drosophilidae
9.5%
Blattidae
5.0%
Kalotermitidae
5.0%
Formicidae
5.0%
Anthocoridae
4.5%
Scarabaeidae
3.2%
Culicidae
3.2%
Elmidae
2.7%
Tenebrionidae
2.7%
Armadillidiidae
1.8%
Cambaridae
1.8%
Dytiscidae
1.8%
Rhinotermitidae
1.4%
Nephropidae
1.4%
Passalidae
1.4%
Termopsidae
0.9%
Chironomidae
0.5%
Hydrophilidae
0.5%
Curculionidae
0.5%
Thomisidae
0.5%
Calliphoridae
0.5%
Hodotermitidae
0.5%
Noctuidae
0.5%
Euphausiidae
0.5%
Ceratopogonidae
0.5%
Penaeidae
0.5%
Taxonomy
Archaea
0
Bacteria
340
Eukaryota
0
Viruses
0
Unclassified
26
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 2 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 3 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 4 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 5 | 2820477775 | Unclassified Firmicutes Lab288P1bin79 | Isolate | Unclassified |
| 6 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 7 | 2540341224 | Williamsoniiplasma luminosum ATCC 49195 | Isolate | Unclassified |
| 8 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 9 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 10 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 11 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 12 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 17 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 18 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 19 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 24 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 25 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 26 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 27 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 28 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 29 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 30 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 31 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 32 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 33 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 34 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 35 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 36 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 37 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 38 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 39 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 40 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 41 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 42 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 43 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 44 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 45 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 48 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 49 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 50 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 51 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 52 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 53 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 54 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 55 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 56 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 57 | 2820935937 | Unclassified Actinobacteria Emb289P1bin40 | Isolate | Unclassified |
| 58 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 59 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 60 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 61 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 62 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 63 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 64 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 65 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 66 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 67 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 68 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 69 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 70 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 71 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 72 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 73 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 74 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 75 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 76 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 77 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 78 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 79 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 80 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 81 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 82 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 83 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 84 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 85 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 86 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 87 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 88 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 89 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 90 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 91 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 92 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 93 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 94 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 95 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 96 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 97 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 98 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 99 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 100 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 101 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 102 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 103 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 104 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 105 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 106 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 107 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 108 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 109 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 110 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 111 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 112 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 113 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 114 | 8112490586 | Staphylococcus muscae CCM 4175 | Isolate | |
| 115 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 116 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 117 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 118 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 119 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 120 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 121 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 122 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 123 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 124 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 125 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 126 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 127 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 128 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 129 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 130 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 131 | 2917496769 | Staphylococcus muscae DSM 7068 | Isolate | Unclassified |
| 132 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 133 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 134 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 135 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 136 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 137 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 138 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 139 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 140 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 141 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 142 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 143 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 144 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 145 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 146 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 147 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 148 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 149 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 150 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 151 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 152 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 153 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 154 | 2540341223 | Entomoplasma lucivorax ATCC 49196 | Isolate | Unclassified |
| 155 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 156 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 157 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 158 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 159 | 2914375287 | Culicoidibacter larvae CS-1 | Isolate | Ceratopogonidae |
| 160 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 161 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 162 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 163 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 164 | 8012112996 | Staphylococcus muscae ATCC 49910 | Isolate | |
| 165 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 166 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 167 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 168 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 169 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 170 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 171 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 172 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 173 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 174 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 175 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 176 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 177 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 178 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 179 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 180 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 181 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 182 | 2820528380 | Unclassified Firmicutes Lab288P1bin143 | Isolate | Unclassified |
| 183 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 184 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 185 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 186 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 187 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 188 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 189 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 190 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 191 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 192 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 193 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 194 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 195 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 196 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 197 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 198 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 199 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 200 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 201 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 202 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 203 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 204 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 205 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 206 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 207 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 208 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 209 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 210 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 211 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 212 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 213 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 214 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 215 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 216 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 217 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 218 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 219 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 220 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 221 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 222 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 223 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 224 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 225 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 226 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 227 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 228 | 3300007763 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut | Metagenome | Drosophilidae |
| 229 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 230 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 231 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 232 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 233 | 3300026545 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp1 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_209053 | 3300042612 | Bacteria | 327332 |
| 2 | Ga0562378_2921 | 3300056814 | Bacteria | 12097 |
| 3 | Ga0562377_0198 | 3300056842 | Bacteria | 157784 |
| 4 | Ga0562376_0642 | 3300056857 | Unclassified | 58868 |
| 5 | Ga0466713_091792 | 3300042602 | Bacteria | 17323 |
| 6 | Ga0466714_090314 | 3300042603 | Bacteria | 1058 |
| 7 | Ga0466719_214233 | 3300042606 | Bacteria | 25065 |
| 8 | Ga0123355_10000691 | 3300009826 | Bacteria | 45851 |
| 9 | Ga0123355_10643581 | 3300009826 | Bacteria | 1240 |
| 10 | Ga0123356_10339864 | 3300010049 | Bacteria | 1621 |
| 11 | Ga0123356_10528184 | 3300010049 | Bacteria | 1339 |
| 12 | Ga0123353_10001036 | 3300010167 | Bacteria | 34063 |
| 13 | Ga0123354_10194923 | 3300010882 | Bacteria | 2252 |
| 14 | Ga0160466_102433 | 3300012809 | Unclassified | 3678 |
| 15 | Ga0160455_102105 | 3300012837 | Unclassified | 4559 |
| 16 | Ga0160472_100093 | 3300012839 | Bacteria | 143816 |
| 17 | Ga0160443_100032 | 3300012848 | Bacteria | 340049 |
| 18 | Ga0160430_109366 | 3300012852 | Bacteria | 1763 |
| 19 | Ga0160457_1001921 | 3300012858 | Bacteria | 4969 |
| 20 | Ga0415639_017343 | 3300038395 | Bacteria | 29930 |
| 21 | Ga0466692_187374 | 3300042591 | Bacteria | 2145 |
| 22 | Ga0466696_311418 | 3300042596 | Bacteria | 1418 |
| 23 | Ga0466730_050838 | 3300042625 | Bacteria | 5056 |
| 24 | Ga0466723_362085 | 3300042618 | Bacteria | 14425 |
| 25 | Ga0466728_448394 | 3300042620 | Bacteria | 23247 |
| 26 | IMNBGM34_c010561 | 3300000036 | Bacteria | 1166 |
| 27 | JGI24700J35501_10930805 | 3300002508 | Bacteria | 24845 |
| 28 | Ga0074278_123997 | 3300005721 | Bacteria | 11946 |
| 29 | Ga0466705_236441 | 3300042612 | Bacteria | 1731 |
| 30 | Ga0562376_0324 | 3300056857 | Bacteria | 94140 |
| 31 | Ga0466706_054307 | 3300042599 | Bacteria | 7678 |
| 32 | Ga0466706_183415 | 3300042599 | Bacteria | 1010 |
| 33 | Ga0466707_277246 | 3300042601 | Bacteria | 3912 |
| 34 | Ga0466713_017270 | 3300042602 | Bacteria | 126285 |
| 35 | Ga0466713_096652 | 3300042602 | Bacteria | 27109 |
| 36 | Ga0466713_149740 | 3300042602 | Bacteria | 2889 |
| 37 | Ga0466719_046122 | 3300042606 | Bacteria | 3836 |
| 38 | Ga0466722_083014 | 3300042609 | Bacteria | 6310 |
| 39 | Ga0466722_139148 | 3300042609 | Bacteria | 4434 |
| 40 | Ga0466697_008197 | 3300042611 | Bacteria | 2289 |
| 41 | Ga0123355_10002510 | 3300009826 | Bacteria | 25993 |
| 42 | Ga0123355_10854288 | 3300009826 | Bacteria | 1000 |
| 43 | Ga0123353_10774865 | 3300010167 | Bacteria | 1330 |
| 44 | Ga0123354_10280197 | 3300010882 | Bacteria | 1621 |
| 45 | Ga0160454_100024 | 3300012798 | Bacteria | 291152 |
| 46 | Ga0160441_100149 | 3300012825 | Bacteria | 75675 |
| 47 | Ga0160452_101907 | 3300012834 | Unclassified | 5142 |
| 48 | Ga0255574_1000019 | 3300026545 | Bacteria | 82376 |
| 49 | Ga0415639_189638 | 3300038395 | Bacteria | 1935 |
| 50 | Ga0466692_084352 | 3300042591 | Bacteria | 1116 |
| 51 | Ga0466692_125499 | 3300042591 | Bacteria | 16994 |
| 52 | Ga0466691_101558 | 3300042593 | Bacteria | 3033 |
| 53 | Ga0466734_012509 | 3300042623 | Bacteria | 3447 |
| 54 | Ga0466703_030157 | 3300042636 | Bacteria | 26707 |
| 55 | Ga0466724_06827 | 3300042649 | Bacteria | 229782 |
| 56 | Ga0466715_340580 | 3300042616 | Bacteria | 2050 |
| 57 | Ga0466715_413064 | 3300042616 | Bacteria | 18615 |
| 58 | IMNBL1DRAFT_c0000245 | 3300000062 | Bacteria | 48003 |
| 59 | Ga0562375_2585 | 3300056856 | Unclassified | 19723 |
| 60 | Ga0466707_183577 | 3300042601 | Bacteria | 1374 |
| 61 | Ga0466716_007623 | 3300042605 | Bacteria | 21316 |
| 62 | Ga0123355_10084566 | 3300009826 | Bacteria | 5051 |
| 63 | Ga0123355_10564792 | 3300009826 | Bacteria | 1368 |
| 64 | Ga0123355_10817003 | 3300009826 | Bacteria | 1035 |
| 65 | Ga0123356_10830792 | 3300010049 | Bacteria | 1095 |
| 66 | Ga0123353_10003098 | 3300010167 | Unclassified | 20834 |
| 67 | Ga0123353_10008443 | 3300010167 | Bacteria | 14066 |
| 68 | Ga0160431_100546 | 3300012828 | Unclassified | 14728 |
| 69 | Ga0160452_100106 | 3300012834 | Bacteria | 109010 |
| 70 | Ga0160472_106261 | 3300012839 | Unclassified | 1792 |
| 71 | Ga0160445_101517 | 3300012847 | Bacteria | 6366 |
| 72 | Ga0160430_100442 | 3300012852 | Unclassified | 24096 |
| 73 | Ga0160436_1000050 | 3300012861 | Bacteria | 65546 |
| 74 | Ga0415639_066870 | 3300038395 | Bacteria | 5516 |
| 75 | Ga0466692_087190 | 3300042591 | Bacteria | 41528 |
| 76 | Ga0466696_481029 | 3300042596 | Bacteria | 12802 |
| 77 | Ga0466704_433640 | 3300042643 | Bacteria | 2735 |
| 78 | Ga0466727_036054 | 3300042655 | Bacteria | 2768 |
| 79 | Ga0466715_246688 | 3300042616 | Bacteria | 1741 |
| 80 | IMNBL1DRAFT_c0004779 | 3300000062 | Bacteria | 8001 |
| 81 | IMNBL1DRAFT_c0006627 | 3300000062 | Bacteria | 6278 |
| 82 | JGI24702J35022_10003480 | 3300002462 | Bacteria | 9479 |
| 83 | JGI24703J35330_11748872 | 3300002501 | Bacteria | 111701 |
| 84 | CVPL010W_10001893 | 3300002931 | Bacteria | 24671 |
| 85 | Ga0074278_141774 | 3300005721 | Bacteria | 3041 |
| 86 | Ga0103265_1004283 | 3300007068 | Bacteria | 2031 |
| 87 | Ga0102734_1000055 | 3300007129 | Bacteria | 36403 |
| 88 | Ga0466733_197901 | 3300042659 | Unclassified | 13008 |
| 89 | Ga0530661_000040 | 3300056564 | Bacteria | 149990 |
| 90 | Ga0562379_0173 | 3300056790 | Bacteria | 189758 |
| 91 | Ga0562379_0885 | 3300056790 | Bacteria | 44905 |
| 92 | Ga0562377_1372 | 3300056842 | Unclassified | 25924 |
| 93 | Ga0466714_076033 | 3300042603 | Bacteria | 11842 |
| 94 | Ga0466714_105936 | 3300042603 | Bacteria | 1105 |
| 95 | Ga0466722_185509 | 3300042609 | Bacteria | 7169 |
| 96 | Ga0123357_10184559 | 3300009784 | Unclassified | 2424 |
| 97 | Ga0123355_10003220 | 3300009826 | Bacteria | 23326 |
| 98 | Ga0123355_10012607 | 3300009826 | Unclassified | 13101 |
| 99 | Ga0123355_10047245 | 3300009826 | Bacteria | 7000 |
| 100 | Ga0123355_10544257 | 3300009826 | Bacteria | 1407 |
| 101 | Ga0123356_10159912 | 3300010049 | Bacteria | 2248 |
| 102 | Ga0160464_100048 | 3300012805 | Bacteria | 142330 |
| 103 | Ga0160464_104846 | 3300012805 | Bacteria | 1628 |
| 104 | Ga0160453_103213 | 3300012814 | Unclassified | 3499 |
| 105 | Ga0160446_100704 | 3300012835 | Bacteria | 11064 |
| 106 | Ga0466693_150988 | 3300042592 | Bacteria | 3544 |
| 107 | Ga0466696_244893 | 3300042596 | Bacteria | 1271 |
| 108 | Ga0466696_251180 | 3300042596 | Bacteria | 10587 |
| 109 | Ga0466729_229282 | 3300042621 | Bacteria | 13857 |
| 110 | Ga0466703_164271 | 3300042636 | Bacteria | 1389 |
| 111 | Ga0466715_061408 | 3300042616 | Bacteria | 135358 |
| 112 | Ga0466715_373657 | 3300042616 | Bacteria | 101520 |
| 113 | Ga0466728_409230 | 3300042620 | Bacteria | 1773 |
| 114 | 2227441928 | 2225789004 | Bacteria | 5476 |
| 115 | Ga0068302_10084186 | 3300005071 | Bacteria | 4764 |
| 116 | Ga0103264_1031314 | 3300007188 | Bacteria | 2440 |
| 117 | Ga0105004_1054346 | 3300007763 | Bacteria | 8928 |
| 118 | Ga0466705_219252 | 3300042612 | Bacteria | 2032 |
| 119 | Ga0562379_0130 | 3300056790 | Bacteria | 234270 |
| 120 | Ga0562375_0228 | 3300056856 | Bacteria | 155616 |
| 121 | Ga0562376_4956 | 3300056857 | Bacteria | 9767 |
| 122 | Ga0466706_015851 | 3300042599 | Bacteria | 1362 |
| 123 | Ga0466717_209738 | 3300042604 | Bacteria | 1165 |
| 124 | Ga0123355_10204911 | 3300009826 | Bacteria | 2872 |
| 125 | Ga0123355_10620555 | 3300009826 | Bacteria | 1275 |
| 126 | Ga0123355_11001518 | 3300009826 | Unclassified | 887 |
| 127 | Ga0123356_10034931 | 3300010049 | Bacteria | 4698 |
| 128 | Ga0123353_10223485 | 3300010167 | Bacteria | 2942 |
| 129 | Ga0123353_11381444 | 3300010167 | Bacteria | 907 |
| 130 | Ga0123353_11828771 | 3300010167 | Bacteria | 753 |
| 131 | Ga0160471_101298 | 3300012812 | Bacteria | 5134 |
| 132 | Ga0160440_103161 | 3300012815 | Unclassified | 1626 |
| 133 | Ga0316159_10320 | 3300030930 | Bacteria | 7703 |
| 134 | Ga0466703_228614 | 3300042636 | Bacteria | 1038 |
| 135 | Ga0466705_531756 | 3300042612 | Bacteria | 8391 |
| 136 | Ga0466715_016727 | 3300042616 | Unclassified | 1340 |
| 137 | Ga0466723_143888 | 3300042618 | Bacteria | 21872 |
| 138 | Ga0466723_324776 | 3300042618 | Bacteria | 22958 |
| 139 | Ga0072940_1098235 | 3300005200 | Bacteria | 1084 |
| 140 | Ga0103264_1000139 | 3300007188 | Bacteria | 42167 |
| 141 | Ga0466705_382065 | 3300042612 | Bacteria | 3331 |
| 142 | Ga0466733_217587 | 3300042659 | Bacteria | 5249 |
| 143 | Ga0562375_0759 | 3300056856 | Bacteria | 56443 |
| 144 | Ga0562376_0295 | 3300056857 | Bacteria | 98008 |
| 145 | Ga0466713_137560 | 3300042602 | Bacteria | 64710 |
| 146 | Ga0466716_074423 | 3300042605 | Bacteria | 3653 |
| 147 | Ga0123355_10024803 | 3300009826 | Bacteria | 9642 |
| 148 | Ga0123355_10069835 | 3300009826 | Bacteria | 5645 |
| 149 | Ga0123355_10223306 | 3300009826 | Bacteria | 2705 |
| 150 | Ga0123355_10375819 | 3300009826 | Bacteria | 1857 |
| 151 | Ga0123355_10569031 | 3300009826 | Bacteria | 1361 |
| 152 | Ga0123353_10032498 | 3300010167 | Bacteria | 8104 |
| 153 | Ga0123353_10259147 | 3300010167 | Bacteria | 2688 |
| 154 | Ga0160464_100938 | 3300012805 | Unclassified | 14459 |
| 155 | Ga0160430_108401 | 3300012852 | Bacteria | 1955 |
| 156 | Ga0160435_1001186 | 3300012857 | Unclassified | 6789 |
| 157 | Ga0160436_1002893 | 3300012861 | Bacteria | 4284 |
| 158 | Ga0466693_247054 | 3300042592 | Bacteria | 3731 |
| 159 | Ga0466701_005673 | 3300042598 | Bacteria | 35320 |
| 160 | Ga0466730_030699 | 3300042625 | Bacteria | 3102 |
| 161 | Ga0466708_453253 | 3300042652 | Bacteria | 8501 |
| 162 | Ga0466710_096910 | 3300042613 | Bacteria | 4453 |
| 163 | Ga0466715_634857 | 3300042616 | Bacteria | 10468 |
| 164 | Ga0466723_187042 | 3300042618 | Bacteria | 6015 |
| 165 | Ga0466729_128263 | 3300042621 | Bacteria | 7812 |
| 166 | 2227552397 | 2225789004 | Bacteria | 15024 |
| 167 | IMNBL1DRAFT_c0051058 | 3300000062 | Unclassified | 1305 |
| 168 | JGI24703J35330_11748214 | 3300002501 | Unclassified | 12109 |
| 169 | CVPL005L_10014181 | 3300002938 | Bacteria | 5439 |
| 170 | Ga0466705_249242 | 3300042612 | Bacteria | 28494 |
| 171 | Ga0562378_1300 | 3300056814 | Unclassified | 28267 |
| 172 | Ga0466706_091108 | 3300042599 | Bacteria | 1265 |
| 173 | Ga0466707_046751 | 3300042601 | Bacteria | 2918 |
| 174 | Ga0466714_024490 | 3300042603 | Bacteria | 21789 |
| 175 | Ga0466719_361825 | 3300042606 | Unclassified | 6059 |
| 176 | Ga0123357_10005462 | 3300009784 | Bacteria | 15230 |
| 177 | Ga0123355_10000149 | 3300009826 | Bacteria | 83900 |
| 178 | Ga0123356_11039729 | 3300010049 | Bacteria | 989 |
| 179 | Ga0123353_10655513 | 3300010167 | Bacteria | 1485 |
| 180 | Ga0255572_1000064 | 3300026175 | Unclassified | 85032 |
| 181 | Ga0466694_167879 | 3300042594 | Bacteria | 2549 |
| 182 | Ga0466730_016925 | 3300042625 | Bacteria | 2484 |
| 183 | Ga0466703_009939 | 3300042636 | Bacteria | 3520 |
| 184 | Ga0466724_27775 | 3300042649 | Bacteria | 35434 |
| 185 | Ga0466723_119921 | 3300042618 | Bacteria | 14759 |
| 186 | JGI24695J34938_10000941 | 3300002450 | Bacteria | 26564 |
| 187 | Ga0466706_229009 | 3300042599 | Unclassified | 2870 |
| 188 | Ga0466721_182333 | 3300042608 | Bacteria | 1885 |
| 189 | Ga0123355_10000029 | 3300009826 | Bacteria | 143843 |
| 190 | Ga0123355_10003229 | 3300009826 | Bacteria | 23291 |
| 191 | Ga0123355_10020895 | 3300009826 | Bacteria | 10469 |
| 192 | Ga0123355_10030070 | 3300009826 | Bacteria | 8801 |
| 193 | Ga0123355_10199871 | 3300009826 | Bacteria | 2923 |
| 194 | Ga0123355_10510883 | 3300009826 | Bacteria | 1476 |
| 195 | Ga0123356_10000460 | 3300010049 | Bacteria | 45572 |
| 196 | Ga0123356_10078399 | 3300010049 | Bacteria | 3118 |
| 197 | Ga0123353_10270289 | 3300010167 | Bacteria | 2620 |
| 198 | Ga0160442_100823 | 3300012806 | Unclassified | 4767 |
| 199 | Ga0160446_102132 | 3300012835 | Bacteria | 3650 |
| 200 | Ga0160434_102593 | 3300012850 | Bacteria | 3112 |
| 201 | Ga0415639_169847 | 3300038395 | Bacteria | 3417 |
| 202 | Ga0466696_215628 | 3300042596 | Bacteria | 88162 |
| 203 | Ga0466703_072309 | 3300042636 | Bacteria | 225639 |
| 204 | Ga0466703_226309 | 3300042636 | Bacteria | 36506 |
| 205 | Ga0466704_155700 | 3300042643 | Bacteria | 31340 |
| 206 | Ga0466727_316689 | 3300042655 | Bacteria | 58164 |
| 207 | Ga0466715_296378 | 3300042616 | Bacteria | 1387 |
| 208 | Ga0466728_367058 | 3300042620 | Bacteria | 2671 |
| 209 | Ga0466729_132574 | 3300042621 | Bacteria | 3743 |
| 210 | IMNBL1DRAFT_c0000174 | 3300000062 | Bacteria | 57893 |
| 211 | IMNBL1DRAFT_c0001907 | 3300000062 | Bacteria | 15091 |
| 212 | JGI24695J34938_10001212 | 3300002450 | Bacteria | 22856 |
| 213 | JGI24697J35500_11274488 | 3300002507 | Bacteria | 7476 |
| 214 | CVPL005L_10015845 | 3300002938 | Bacteria | 9966 |
| 215 | Ga0104019_1196570 | 3300007150 | Bacteria | 1138 |
| 216 | Ga0103268_1028660 | 3300007192 | Bacteria | 1304 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.