Protein Family IF04670
Metagenome
Isolate
293
Members
139
Samples
223
Scaffolds
509.14
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_107605|Ga0466692_107605_38_1744
- Length
- 557 aa
- Sequence
- MFPPQISFHAPLRTRCLNLTTPFRKDQRKYISLKNKIYIIENSRIFPAGLAFFHILALYEPMIIGAERLTIEKLVSAAKGECPVRLWDSPEFAAKIDRGAEFLDEAIAAKGGIYGVTTGYGDSCTETVPSDHYYDLPVHLTRYHGCGLGEYFDPETVRAIMIVRLNTLAQGFSGVSFELLRYIAFFLEHDILPLIPQEGSVGASGDLTPLSYLAGALIGERDAIYHGRVRSSAEVLAELGKPVYRFRPKEAIAIMNGTAVMNAASAVAFSRAEYLADLSCRITAMNSLALKGNRYHFYPRLFEAKPHAGQNRAAALILAALGGQNASDAAEVFPERIQDQYSIRCAPHIIGLFYDAADMLRRFIETEMNSANDNPIIDPATRSVYHGGHFYGGHICFAMDALKNIIANLADLIDRQFALVVDKKFNRGLPPNLSGAAEVSYNHGFKAAQIAASAWTAEALKNTMPASVFSRSTECHNQDKVSMGTIAARDCLRVIELTGQTLSAGLLGAAQALHLRLRLAETYRQVFSYFAPLEEDRPLEKDLRTTAALIEQRFFSV
Sample Types
Isolate
23.9%
Metagenome
76.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
36.2%
Termitidae
18.1%
Kalotermitidae
10.2%
Formicidae
7.1%
Elmidae
6.3%
Curculionidae
4.7%
Culicidae
3.9%
Armadillidiidae
3.1%
Talitridae
2.4%
Rhinotermitidae
2.4%
Termopsidae
2.4%
Majidae
1.6%
Artemiidae
0.8%
Siricidae
0.8%
Taxonomy
Archaea
0
Bacteria
272
Eukaryota
0
Viruses
1
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 2 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 3 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 4 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 5 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 6 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 7 | 2820714932 | Unclassified Fibrobacteres Nc150P4bin10 | Isolate | Unclassified |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 15 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 16 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 17 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 22 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 23 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 26 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 36 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 37 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 38 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 39 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 40 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 41 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 42 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 43 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 44 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 45 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 46 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 47 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 48 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 49 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 50 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 51 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 52 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 53 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 54 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 55 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 56 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 57 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 58 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 59 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 60 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 61 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 62 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 63 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 64 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 65 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 66 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 67 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 68 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 69 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 70 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 71 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 72 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 73 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 74 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 75 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 76 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 77 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 78 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 79 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 80 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 81 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 82 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 83 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 84 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 85 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 86 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 87 | 2820716747 | Unclassified Fibrobacteres Nc150P3bin18 | Isolate | Unclassified |
| 88 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 89 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 90 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 91 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 92 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 93 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 94 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 95 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 96 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 97 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 98 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 99 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 100 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 101 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 102 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 103 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 104 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 105 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 106 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 107 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 108 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 109 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 110 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 111 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 112 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 113 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 114 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 115 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 116 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 117 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 118 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 119 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 120 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 121 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 122 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 123 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 124 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 125 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 126 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 127 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 128 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 129 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 130 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 131 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 132 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 133 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 134 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 135 | 2972038244 | Pseudomonas sp. DS1 | Isolate | Formicidae |
| 136 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 137 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 138 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 139 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_060583 | 3300042614 | Bacteria | 12544 |
| 2 | Ga0466718_114707 | 3300042617 | Bacteria | 3097 |
| 3 | Ga0466718_167659 | 3300042617 | Bacteria | 2823 |
| 4 | Ga0466726_132283 | 3300042619 | Bacteria | 9974 |
| 5 | Ga0466726_251100 | 3300042619 | Bacteria | 2529 |
| 6 | Ga0123353_10086412 | 3300010167 | Bacteria | 5051 |
| 7 | Ga0264413_107725 | 3300024493 | Bacteria | 7350 |
| 8 | Ga0415639_053543 | 3300038395 | Bacteria | 9326 |
| 9 | Ga0456237_0002241 | 3300041968 | Bacteria | 3129 |
| 10 | Ga0466692_107605 | 3300042591 | Bacteria | 11086 |
| 11 | Ga0466693_084705 | 3300042592 | Bacteria | 3708 |
| 12 | Ga0466699_080283 | 3300042597 | Bacteria | 3009 |
| 13 | DPO_contig01287 | 2032320009 | Unclassified | 51092 |
| 14 | AustNasuHG_c1001809 | 3300000089 | Bacteria | 7729 |
| 15 | AustNasuHG_c1008440 | 3300000089 | Unclassified | 3646 |
| 16 | JGI24698J34947_10000478 | 3300002449 | Bacteria | 18766 |
| 17 | JGI24695J34938_10001065 | 3300002450 | Bacteria | 24814 |
| 18 | Ga0072941_1000453 | 3300005201 | Bacteria | 5472 |
| 19 | Ga0072941_1012769 | 3300005201 | Bacteria | 4144 |
| 20 | Ga0072941_1029587 | 3300005201 | Bacteria | 11163 |
| 21 | Ga0072941_1112056 | 3300005201 | Bacteria | 1780 |
| 22 | Ga0074263_111914 | 3300005485 | Bacteria | 4532 |
| 23 | Ga0466720_197193 | 3300042607 | Bacteria | 9208 |
| 24 | Ga0466722_080365 | 3300042609 | Bacteria | 4736 |
| 25 | Ga0466722_119822 | 3300042609 | Bacteria | 12048 |
| 26 | Ga0466704_051108 | 3300042643 | Bacteria | 9065 |
| 27 | Ga0466709_017666 | 3300042648 | Unclassified | 5082 |
| 28 | Ga0466708_397302 | 3300042652 | Bacteria | 2207 |
| 29 | Ga0466727_125991 | 3300042655 | Bacteria | 25498 |
| 30 | Ga0466727_299896 | 3300042655 | Bacteria | 1721 |
| 31 | Ga0466718_093367 | 3300042617 | Bacteria | 14318 |
| 32 | Ga0123355_10095735 | 3300009826 | Bacteria | 4691 |
| 33 | Ga0160466_101188 | 3300012809 | Bacteria | 8020 |
| 34 | Ga0415639_016675 | 3300038395 | Bacteria | 4055 |
| 35 | Ga0466694_051046 | 3300042594 | Bacteria | 57740 |
| 36 | Ga0466699_413766 | 3300042597 | Bacteria | 7948 |
| 37 | AustNasuHG_c1004028 | 3300000089 | Unclassified | 5289 |
| 38 | JGI24698J34947_10003629 | 3300002449 | Bacteria | 8385 |
| 39 | JGI24698J34947_10028833 | 3300002449 | Bacteria | 2937 |
| 40 | Ga0072941_1003985 | 3300005201 | Bacteria | 10146 |
| 41 | Ga0072941_1005729 | 3300005201 | Bacteria | 49202 |
| 42 | Ga0072941_1005944 | 3300005201 | Bacteria | 44163 |
| 43 | Ga0074263_109350 | 3300005485 | Bacteria | 4419 |
| 44 | Ga0103263_100116 | 3300007042 | Bacteria | 25577 |
| 45 | Ga0103261_1000911 | 3300007083 | Bacteria | 9360 |
| 46 | Ga0102734_1003605 | 3300007129 | Bacteria | 6918 |
| 47 | Ga0466707_374812 | 3300042601 | Bacteria | 1806 |
| 48 | Ga0466720_024523 | 3300042607 | Bacteria | 19006 |
| 49 | Ga0466720_080056 | 3300042607 | Bacteria | 10125 |
| 50 | Ga0466720_128458 | 3300042607 | Bacteria | 29477 |
| 51 | Ga0466720_149293 | 3300042607 | Bacteria | 43020 |
| 52 | Ga0466720_238860 | 3300042607 | Bacteria | 102895 |
| 53 | Ga0466722_041107 | 3300042609 | Bacteria | 3526 |
| 54 | Ga0466703_062328 | 3300042636 | Bacteria | 3299 |
| 55 | Ga0466709_174002 | 3300042648 | Bacteria | 3899 |
| 56 | Ga0466712_026405 | 3300042614 | Bacteria | 20296 |
| 57 | Ga0466712_093217 | 3300042614 | Bacteria | 3876 |
| 58 | Ga0466712_104665 | 3300042614 | Bacteria | 9540 |
| 59 | Ga0466712_168936 | 3300042614 | Bacteria | 19707 |
| 60 | Ga0466715_106710 | 3300042616 | Bacteria | 8951 |
| 61 | Ga0466718_037950 | 3300042617 | Bacteria | 16327 |
| 62 | Ga0466718_130375 | 3300042617 | Bacteria | 7703 |
| 63 | Ga0466726_145691 | 3300042619 | Bacteria | 2992 |
| 64 | Ga0123356_10011721 | 3300010049 | Bacteria | 8534 |
| 65 | Ga0160456_100236 | 3300012820 | Unclassified | 27922 |
| 66 | Ga0160446_100120 | 3300012835 | Unclassified | 70103 |
| 67 | Ga0264413_107804 | 3300024493 | Bacteria | 18094 |
| 68 | Ga0264413_114646 | 3300024493 | Bacteria | 3977 |
| 69 | Ga0466690_116530 | 3300042590 | Bacteria | 11509 |
| 70 | Ga0466694_299122 | 3300042594 | Bacteria | 2081 |
| 71 | Ga0466699_003150 | 3300042597 | Bacteria | 5581 |
| 72 | Ga0466699_011683 | 3300042597 | Bacteria | 15186 |
| 73 | AustNasuHG_c1004858 | 3300000089 | Bacteria | 4811 |
| 74 | Ga0072941_1051099 | 3300005201 | Bacteria | 4326 |
| 75 | Ga0072941_1073078 | 3300005201 | Bacteria | 3824 |
| 76 | Ga0103268_1001554 | 3300007192 | Bacteria | 5627 |
| 77 | Ga0466717_099522 | 3300042604 | Bacteria | 4387 |
| 78 | Ga0466720_142258 | 3300042607 | Bacteria | 17236 |
| 79 | Ga0466720_173608 | 3300042607 | Bacteria | 13917 |
| 80 | Ga0466720_217425 | 3300042607 | Bacteria | 21579 |
| 81 | Ga0466722_021973 | 3300042609 | Bacteria | 8920 |
| 82 | Ga0466735_088967 | 3300042624 | Bacteria | 9373 |
| 83 | Ga0466703_079044 | 3300042636 | Bacteria | 6737 |
| 84 | Ga0466727_033118 | 3300042655 | Unclassified | 12393 |
| 85 | Ga0466712_063329 | 3300042614 | Bacteria | 10209 |
| 86 | Ga0466712_204469 | 3300042614 | Bacteria | 34311 |
| 87 | Ga0466715_164747 | 3300042616 | Bacteria | 8004 |
| 88 | Ga0466718_015101 | 3300042617 | Bacteria | 2611 |
| 89 | Ga0466718_058388 | 3300042617 | Bacteria | 5216 |
| 90 | Ga0466718_079204 | 3300042617 | Bacteria | 21805 |
| 91 | Ga0466726_083373 | 3300042619 | Bacteria | 50291 |
| 92 | Ga0160445_100210 | 3300012847 | Bacteria | 43649 |
| 93 | Ga0264413_107726 | 3300024493 | Bacteria | 7599 |
| 94 | Ga0264413_113519 | 3300024493 | Bacteria | 6821 |
| 95 | SWWA_contig03115__length_4164___numreads_42 | 2100351016 | Unclassified | 4164 |
| 96 | SWWA_contig31637__length_51298___numreads_3000 | 2100351016 | Bacteria | 51298 |
| 97 | JGI24698J34947_10015595 | 3300002449 | Bacteria | 4136 |
| 98 | Ga0466720_035337 | 3300042607 | Bacteria | 3617 |
| 99 | Ga0466732_262374 | 3300042656 | Bacteria | 16043 |
| 100 | Ga0466702_045619 | 3300042635 | Bacteria | 10997 |
| 101 | Ga0466702_168838 | 3300042635 | Bacteria | 3665 |
| 102 | Ga0466703_430151 | 3300042636 | Bacteria | 25228 |
| 103 | Ga0466704_107735 | 3300042643 | Bacteria | 2881 |
| 104 | Ga0466704_117748 | 3300042643 | Bacteria | 7559 |
| 105 | Ga0466712_114401 | 3300042614 | Bacteria | 32646 |
| 106 | Ga0123356_10000369 | 3300010049 | Bacteria | 51376 |
| 107 | Ga0160467_102736 | 3300012829 | Unclassified | 3548 |
| 108 | Ga0466692_066226 | 3300042591 | Bacteria | 16969 |
| 109 | Ga0466691_015139 | 3300042593 | Bacteria | 9575 |
| 110 | Ga0466699_282942 | 3300042597 | Bacteria | 14440 |
| 111 | SPBB_contig11543 | 2044078006 | Unclassified | 52054 |
| 112 | JGI24695J34938_10000611 | 3300002450 | Bacteria | 34277 |
| 113 | JGI24695J34938_10002079 | 3300002450 | Bacteria | 15713 |
| 114 | JGI24695J34938_10006258 | 3300002450 | Bacteria | 7218 |
| 115 | JGI24695J34938_10029570 | 3300002450 | Unclassified | 2561 |
| 116 | CVPL005L_10003305 | 3300002938 | Bacteria | 18065 |
| 117 | Ga0072941_1051098 | 3300005201 | Unclassified | 3849 |
| 118 | Ga0103267_1012402 | 3300007190 | Bacteria | 2640 |
| 119 | Ga0103268_1000159 | 3300007192 | Bacteria | 22142 |
| 120 | Ga0466716_533160 | 3300042605 | Bacteria | 8395 |
| 121 | Ga0466719_119883 | 3300042606 | Bacteria | 32227 |
| 122 | Ga0466720_051968 | 3300042607 | Bacteria | 35380 |
| 123 | Ga0466720_093420 | 3300042607 | Bacteria | 11940 |
| 124 | Ga0466733_121183 | 3300042659 | Bacteria | 3605 |
| 125 | Ga0466731_158704 | 3300042622 | Bacteria | 3263 |
| 126 | Ga0466704_032072 | 3300042643 | Bacteria | 14867 |
| 127 | Ga0466708_367437 | 3300042652 | Bacteria | 1838 |
| 128 | Ga0466712_014792 | 3300042614 | Bacteria | 30692 |
| 129 | Ga0466712_073743 | 3300042614 | Bacteria | 10673 |
| 130 | Ga0466712_075967 | 3300042614 | Bacteria | 12403 |
| 131 | Ga0466718_016063 | 3300042617 | Bacteria | 36821 |
| 132 | Ga0466723_145431 | 3300042618 | Bacteria | 3946 |
| 133 | Ga0123356_10000080 | 3300010049 | Bacteria | 102921 |
| 134 | Ga0123356_10002065 | 3300010049 | Bacteria | 21651 |
| 135 | Ga0160454_100272 | 3300012798 | Unclassified | 45834 |
| 136 | Ga0160433_100200 | 3300012846 | Bacteria | 48402 |
| 137 | Ga0160436_1003054 | 3300012861 | Bacteria | 4156 |
| 138 | Ga0264413_150023 | 3300024493 | Bacteria | 2365 |
| 139 | Ga0466699_212908 | 3300042597 | Bacteria | 27449 |
| 140 | DPOL_contig16862 | 2035918003 | Unclassified | 9177 |
| 141 | AustNasuHG_c1000213 | 3300000089 | Bacteria | 19231 |
| 142 | AustNasuHG_c1003496 | 3300000089 | Bacteria | 5678 |
| 143 | JGI24698J34947_10000252 | 3300002449 | Bacteria | 22585 |
| 144 | JGI24698J34947_10001633 | 3300002449 | Bacteria | 11937 |
| 145 | JGI24698J34947_10015769 | 3300002449 | Bacteria | 4109 |
| 146 | JGI24695J34938_10000657 | 3300002450 | Bacteria | 32770 |
| 147 | JGI24695J34938_10015656 | 3300002450 | Bacteria | 3885 |
| 148 | Ga0072941_1000454 | 3300005201 | Bacteria | 22088 |
| 149 | Ga0072941_1000455 | 3300005201 | Bacteria | 18008 |
| 150 | Ga0072941_1047673 | 3300005201 | Bacteria | 12730 |
| 151 | Ga0103265_1000035 | 3300007068 | Bacteria | 24392 |
| 152 | Ga0466701_063769 | 3300042598 | Bacteria | 151198 |
| 153 | Ga0466716_149841 | 3300042605 | Bacteria | 5973 |
| 154 | Ga0466719_300935 | 3300042606 | Bacteria | 2030 |
| 155 | Ga0466720_002785 | 3300042607 | Bacteria | 44479 |
| 156 | Ga0466720_003238 | 3300042607 | Bacteria | 32291 |
| 157 | Ga0466720_045187 | 3300042607 | Bacteria | 27687 |
| 158 | Ga0466720_183549 | 3300042607 | Bacteria | 21136 |
| 159 | Ga0466722_016206 | 3300042609 | Bacteria | 18236 |
| 160 | Ga0466722_031354 | 3300042609 | Bacteria | 2244 |
| 161 | Ga0466722_094326 | 3300042609 | Bacteria | 7511 |
| 162 | Ga0466735_144705 | 3300042624 | Bacteria | 3153 |
| 163 | Ga0466735_172139 | 3300042624 | Bacteria | 8462 |
| 164 | Ga0466703_186550 | 3300042636 | Bacteria | 31727 |
| 165 | Ga0466703_388281 | 3300042636 | Unclassified | 3993 |
| 166 | Ga0466727_140371 | 3300042655 | Bacteria | 2477 |
| 167 | Ga0466727_189803 | 3300042655 | Bacteria | 15151 |
| 168 | Ga0466712_296486 | 3300042614 | Bacteria | 7162 |
| 169 | Ga0466711_336906 | 3300042615 | Bacteria | 11170 |
| 170 | Ga0466715_066475 | 3300042616 | Bacteria | 13966 |
| 171 | Ga0466718_056069 | 3300042617 | Bacteria | 5219 |
| 172 | Ga0466718_057909 | 3300042617 | Bacteria | 4821 |
| 173 | Ga0466718_122319 | 3300042617 | Bacteria | 7879 |
| 174 | Ga0123356_10340448 | 3300010049 | Viruses | 1620 |
| 175 | Ga0160448_101033 | 3300012854 | Bacteria | 9214 |
| 176 | Ga0466692_018230 | 3300042591 | Bacteria | 4469 |
| 177 | Ga0466693_008868 | 3300042592 | Bacteria | 6670 |
| 178 | Ga0466696_062912 | 3300042596 | Bacteria | 7863 |
| 179 | Ga0466699_019842 | 3300042597 | Bacteria | 2227 |
| 180 | Ga0466699_173210 | 3300042597 | Bacteria | 10801 |
| 181 | Ga0466699_178162 | 3300042597 | Bacteria | 26425 |
| 182 | Ga0466699_250363 | 3300042597 | Bacteria | 8722 |
| 183 | JGI24698J34947_10000259 | 3300002449 | Bacteria | 22495 |
| 184 | JGI24698J34947_10005422 | 3300002449 | Bacteria | 6998 |
| 185 | Ga0072940_1121991 | 3300005200 | Unclassified | 2717 |
| 186 | Ga0072941_1000456 | 3300005201 | Bacteria | 20789 |
| 187 | Ga0072941_1040094 | 3300005201 | Bacteria | 6933 |
| 188 | Ga0102735_1001098 | 3300007080 | Bacteria | 4809 |
| 189 | Ga0466714_036050 | 3300042603 | Bacteria | 39314 |
| 190 | Ga0466720_100261 | 3300042607 | Bacteria | 14659 |
| 191 | Ga0466722_021570 | 3300042609 | Bacteria | 26871 |
| 192 | Ga0466722_204047 | 3300042609 | Bacteria | 6147 |
| 193 | Ga0466722_246006 | 3300042609 | Bacteria | 6505 |
| 194 | Ga0466702_283516 | 3300042635 | Bacteria | 14785 |
| 195 | Ga0466705_483917 | 3300042612 | Bacteria | 4771 |
| 196 | Ga0466712_007985 | 3300042614 | Bacteria | 81055 |
| 197 | Ga0466712_175017 | 3300042614 | Bacteria | 45826 |
| 198 | Ga0466711_311976 | 3300042615 | Bacteria | 2865 |
| 199 | Ga0466718_027705 | 3300042617 | Bacteria | 21984 |
| 200 | Ga0466723_006242 | 3300042618 | Bacteria | 2356 |
| 201 | Ga0466723_178566 | 3300042618 | Bacteria | 20649 |
| 202 | Ga0466723_212626 | 3300042618 | Bacteria | 2916 |
| 203 | Ga0160440_100492 | 3300012815 | Unclassified | 12461 |
| 204 | Ga0160431_101025 | 3300012828 | Bacteria | 8532 |
| 205 | Ga0160472_100309 | 3300012839 | Unclassified | 49465 |
| 206 | Ga0264413_101700 | 3300024493 | Bacteria | 8378 |
| 207 | Ga0264413_103070 | 3300024493 | Bacteria | 25813 |
| 208 | Ga0264413_113758 | 3300024493 | Bacteria | 7015 |
| 209 | Ga0264413_142175 | 3300024493 | Unclassified | 2778 |
| 210 | Ga0466699_307010 | 3300042597 | Bacteria | 3320 |
| 211 | Ga0466699_311866 | 3300042597 | Bacteria | 7636 |
| 212 | SPBB_contig11513 | 2044078006 | Bacteria | 129262 |
| 213 | AustNasuHG_c1007134 | 3300000089 | Bacteria | 3982 |
| 214 | JGI24698J34947_10000471 | 3300002449 | Bacteria | 18816 |
| 215 | JGI24695J34938_10002672 | 3300002450 | Bacteria | 13298 |
| 216 | JGI24695J34938_10015773 | 3300002450 | Bacteria | 3866 |
| 217 | Ga0072941_1012770 | 3300005201 | Bacteria | 4443 |
| 218 | Ga0074263_107053 | 3300005485 | Unclassified | 2018 |
| 219 | Ga0466701_034736 | 3300042598 | Bacteria | 32639 |
| 220 | Ga0466720_062924 | 3300042607 | Bacteria | 42294 |
| 221 | Ga0466720_078388 | 3300042607 | Bacteria | 4798 |
| 222 | Ga0466721_221369 | 3300042608 | Bacteria | 7379 |
| 223 | Ga0466722_250429 | 3300042609 | Bacteria | 13343 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00221 | Lyase_aromatic | Aromatic amino acid lyase | 69 | 521 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.