Protein Family IF04330
Metagenome
Isolate
125
Members
62
Samples
106
Scaffolds
79.07
Avg Length
Representative Sequence
- ID
- 3300038395|Ga0415639_143239|Ga0415639_143239_31_321
- Length
- 96 aa
- Sequence
- MAAQLFKREKVLKGAVFPMTNKEKYINSFTEAFNISEDAALVAKYQVEQSWDSVGHMSLISLLEDTFDIMMDTDDIIDFSSFEKGMEIMQKYDVEI
Sample Types
Isolate
15.2%
Metagenome
84.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.9%
Kalotermitidae
18.6%
Muscidae
13.6%
Unclassified
6.8%
Termopsidae
6.8%
Calliphoridae
5.1%
Sarcophagidae
3.4%
Drosophilidae
1.7%
Hodotermitidae
1.7%
Thripidae
1.7%
Anthomyiidae
1.7%
Rhinotermitidae
1.7%
Plutellidae
1.7%
Formicidae
1.7%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
1
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 2 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 3 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 4 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 12 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 13 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 14 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 20 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 27 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 28 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 39 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 44 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 47 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 48 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 49 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 50 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 55 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 56 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 57 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 58 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 59 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 60 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 61 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 62 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_414444 | 3300042656 | Bacteria | 1385 |
| 2 | Ga0466690_432269 | 3300042590 | Unclassified | 2262 |
| 3 | Ga0466693_219081 | 3300042592 | Bacteria | 1465 |
| 4 | Ga0123355_10001211 | 3300009826 | Bacteria | 35912 |
| 5 | Ga0123356_10038186 | 3300010049 | Bacteria | 4475 |
| 6 | Ga0123356_10127553 | 3300010049 | Unclassified | 2486 |
| 7 | Ga0123356_10324372 | 3300010049 | Bacteria | 1654 |
| 8 | Ga0123356_11186835 | 3300010049 | Bacteria | 930 |
| 9 | Ga0123353_10435868 | 3300010167 | Bacteria | 1935 |
| 10 | Ga0123353_11392632 | 3300010167 | Bacteria | 902 |
| 11 | Ga0072940_1008424 | 3300005200 | Bacteria | 6257 |
| 12 | Ga0466711_358031 | 3300042615 | Bacteria | 8118 |
| 13 | Ga0466727_191015 | 3300042655 | Bacteria | 2083 |
| 14 | Ga0466696_136518 | 3300042596 | Bacteria | 8937 |
| 15 | Ga0123353_10034826 | 3300010167 | Bacteria | 7868 |
| 16 | Ga0123353_10351886 | 3300010167 | Bacteria | 2219 |
| 17 | Ga0123353_10449091 | 3300010167 | Viruses | 1899 |
| 18 | Ga0123354_10549831 | 3300010882 | Bacteria | 871 |
| 19 | JGI24696J40584_12472618 | 3300002834 | Bacteria | 586 |
| 20 | Ga0074263_135925 | 3300005485 | Bacteria | 888 |
| 21 | Ga0466715_104052 | 3300042616 | Unclassified | 1132 |
| 22 | Ga0466707_142708 | 3300042601 | Bacteria | 1873 |
| 23 | Ga0466693_327370 | 3300042592 | Bacteria | 1333 |
| 24 | Ga0123355_10006476 | 3300009826 | Bacteria | 17355 |
| 25 | AustNasuHG_c1001177 | 3300000089 | Bacteria | 9398 |
| 26 | AustNasuHG_c1002946 | 3300000089 | Bacteria | 6131 |
| 27 | AustNasuHG_c1035609 | 3300000089 | Bacteria | 1308 |
| 28 | JGI24695J34938_10000001 | 3300002450 | Bacteria | 290906 |
| 29 | Ga0466726_121684 | 3300042619 | Bacteria | 12626 |
| 30 | Ga0466726_275228 | 3300042619 | Bacteria | 6007 |
| 31 | Ga0466706_062060 | 3300042599 | Bacteria | 24698 |
| 32 | Ga0466714_003663 | 3300042603 | Bacteria | 1320 |
| 33 | Ga0466709_111220 | 3300042648 | Bacteria | 20591 |
| 34 | Ga0415639_065330 | 3300038395 | Unclassified | 1323 |
| 35 | Ga0415639_143239 | 3300038395 | Bacteria | 1354 |
| 36 | Ga0123356_10000006 | 3300010049 | Bacteria | 247371 |
| 37 | AustNasuHG_c1002199 | 3300000089 | Bacteria | 7048 |
| 38 | Ga0466726_160691 | 3300042619 | Bacteria | 1984 |
| 39 | Ga0466735_215968 | 3300042624 | Bacteria | 1652 |
| 40 | Ga0466704_404558 | 3300042643 | Bacteria | 1117 |
| 41 | Ga0466705_140978 | 3300042612 | Bacteria | 8865 |
| 42 | Ga0247290_00203 | 3300035364 | Bacteria | 17718 |
| 43 | Ga0415639_029890 | 3300038395 | Bacteria | 33874 |
| 44 | Ga0415639_072027 | 3300038395 | Bacteria | 2389 |
| 45 | Ga0466690_408944 | 3300042590 | Bacteria | 5419 |
| 46 | JGI24702J35022_10834138 | 3300002462 | Bacteria | 574 |
| 47 | Ga0072940_1042223 | 3300005200 | Bacteria | 6153 |
| 48 | Ga0466707_165640 | 3300042601 | Bacteria | 4904 |
| 49 | Ga0466714_156392 | 3300042603 | Bacteria | 5625 |
| 50 | Ga0466702_004549 | 3300042635 | Bacteria | 1780 |
| 51 | Ga0466725_109018 | 3300042654 | Bacteria | 14452 |
| 52 | Ga0466732_000963 | 3300042656 | Bacteria | 15418 |
| 53 | Ga0264413_126408 | 3300024493 | Bacteria | 3635 |
| 54 | Ga0316159_10072 | 3300030930 | Bacteria | 17468 |
| 55 | Ga0466691_066382 | 3300042593 | Bacteria | 7235 |
| 56 | Ga0466696_044559 | 3300042596 | Bacteria | 7500 |
| 57 | Ga0123356_10382239 | 3300010049 | Bacteria | 1541 |
| 58 | Ga0123356_11716394 | 3300010049 | Bacteria | 779 |
| 59 | Ga0123353_10009421 | 3300010167 | Bacteria | 13481 |
| 60 | Ga0123353_11024517 | 3300010167 | Bacteria | 1106 |
| 61 | Ga0123353_12050452 | 3300010167 | Bacteria | 698 |
| 62 | JGI24705J35276_12238549 | 3300002504 | Bacteria | 26247 |
| 63 | Ga0466723_106037 | 3300042618 | Bacteria | 3191 |
| 64 | Ga0466726_099513 | 3300042619 | Bacteria | 1336 |
| 65 | Ga0466706_149518 | 3300042599 | Unclassified | 1305 |
| 66 | Ga0466706_273421 | 3300042599 | Bacteria | 27290 |
| 67 | Ga0264413_135114 | 3300024493 | Bacteria | 31922 |
| 68 | Ga0466690_248758 | 3300042590 | Bacteria | 30377 |
| 69 | Ga0466696_122880 | 3300042596 | Bacteria | 1820 |
| 70 | Ga0466696_432380 | 3300042596 | Bacteria | 3307 |
| 71 | Ga0123357_10041433 | 3300009784 | Bacteria | 6262 |
| 72 | Ga0123356_10113773 | 3300010049 | Bacteria | 2619 |
| 73 | Ga0123356_10211978 | 3300010049 | Unclassified | 1987 |
| 74 | Ga0123356_10430334 | 3300010049 | Bacteria | 1464 |
| 75 | Ga0123356_10443494 | 3300010049 | Bacteria | 1445 |
| 76 | Ga0123356_10816357 | 3300010049 | Unclassified | 1104 |
| 77 | Ga0123356_12970405 | 3300010049 | Bacteria | 592 |
| 78 | Ga0123353_10880144 | 3300010167 | Bacteria | 1223 |
| 79 | Ga0068302_10952996 | 3300005071 | Bacteria | 511 |
| 80 | Ga0072940_1008409 | 3300005200 | Unclassified | 6161 |
| 81 | Ga0072941_1229558 | 3300005201 | Bacteria | 6814 |
| 82 | Ga0466705_397052 | 3300042612 | Bacteria | 4429 |
| 83 | Ga0466728_385286 | 3300042620 | Bacteria | 24912 |
| 84 | Ga0466706_143312 | 3300042599 | Bacteria | 3167 |
| 85 | Ga0466722_190371 | 3300042609 | Bacteria | 2676 |
| 86 | Ga0466703_022345 | 3300042636 | Bacteria | 41652 |
| 87 | Ga0466709_302719 | 3300042648 | Bacteria | 2180 |
| 88 | Ga0466724_33561 | 3300042649 | Bacteria | 205596 |
| 89 | Ga0265387_1000012 | 3300024582 | Bacteria | 74513 |
| 90 | Ga0415639_048800 | 3300038395 | Bacteria | 2500 |
| 91 | Ga0415639_161467 | 3300038395 | Bacteria | 1877 |
| 92 | Ga0466696_324746 | 3300042596 | Bacteria | 1487 |
| 93 | Ga0123355_10739189 | 3300009826 | Bacteria | 1116 |
| 94 | Ga0123356_10015172 | 3300010049 | Bacteria | 7386 |
| 95 | Ga0123356_10095755 | 3300010049 | Bacteria | 2838 |
| 96 | Ga0123356_11351401 | 3300010049 | Bacteria | 874 |
| 97 | Ga0123356_11945829 | 3300010049 | Bacteria | 733 |
| 98 | Ga0123353_10806186 | 3300010167 | Bacteria | 1295 |
| 99 | Ga0123353_12028532 | 3300010167 | Bacteria | 703 |
| 100 | Ga0123354_10012104 | 3300010882 | Bacteria | 13358 |
| 101 | Ga0123354_10128678 | 3300010882 | Bacteria | 3215 |
| 102 | JGI24705J35276_12160591 | 3300002504 | Bacteria | 1231 |
| 103 | Ga0466715_205772 | 3300042616 | Bacteria | 25802 |
| 104 | Ga0466718_067628 | 3300042617 | Bacteria | 17272 |
| 105 | Ga0466728_237047 | 3300042620 | Bacteria | 2209 |
| 106 | Ga0466727_063553 | 3300042655 | Bacteria | 15964 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.