Protein Family IF04018
Metagenome
Isolate
274
Members
201
Samples
149
Scaffolds
231.22
Avg Length
Representative Sequence
- ID
- 3300012849|Ga0160447_112318|Ga0160447_1123182
- Length
- 212 aa
- Sequence
- MAKKGKKYVEAAKLVDRTQTYSVQAFRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDADYINKIQQGWFEFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVQKAVNEIKAGKVEYRVDKAGNIHVPIGKVSFEESKLVENFTTIFETMVKAKPAAAKGTYMKNVAVTSTMGPGIKVDTASFSA*
Sample Types
Isolate
45.6%
Metagenome
54.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
19.2%
Termitidae
15.4%
Apidae
10.4%
Kalotermitidae
7.1%
Blattidae
6.0%
Drosophilidae
4.4%
Tenebrionidae
4.4%
Formicidae
4.4%
Elmidae
3.8%
Scarabaeidae
3.8%
Pyralidae
2.7%
Rhinotermitidae
1.6%
Bombycidae
1.6%
Termopsidae
1.6%
Noctuidae
1.1%
Culicidae
1.1%
Passalidae
1.1%
Calliphoridae
0.5%
Vespidae
0.5%
Hodotermitidae
0.5%
Dytiscidae
0.5%
Ceratopogonidae
0.5%
Gomphidae
0.5%
Nephropidae
0.5%
Ocypodidae
0.5%
Libellulidae
0.5%
Hydrophilidae
0.5%
Eresidae
0.5%
Armadillidiidae
0.5%
Plutellidae
0.5%
Penaeidae
0.5%
Portunidae
0.5%
Curculionidae
0.5%
Rhaphidophoridae
0.5%
Pyrrhocoridae
0.5%
Taxonomy
Archaea
0
Bacteria
259
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 2 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 3 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 4 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 5 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 6 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 7 | 2820477775 | Unclassified Firmicutes Lab288P1bin79 | Isolate | Unclassified |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 13 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 14 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 15 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 16 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 17 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 18 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 23 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 24 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 25 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 26 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 27 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 28 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 29 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 30 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 31 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 32 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 33 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 34 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 35 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 38 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 39 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 40 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 41 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 42 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 43 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 44 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 45 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 46 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 47 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 48 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 49 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 52 | 2820871393 | Unclassified Actinobacteria Lab288P3bin101 | Isolate | Unclassified |
| 53 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 54 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 55 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 56 | 2914375287 | Culicoidibacter larvae CS-1 | Isolate | Ceratopogonidae |
| 57 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 58 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 59 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 60 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 61 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 62 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 63 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 64 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 65 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 66 | 8012112996 | Staphylococcus muscae ATCC 49910 | Isolate | |
| 67 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 68 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 69 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 70 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 71 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 72 | 3300007901 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii | Metagenome | Formicidae |
| 73 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 74 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 75 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 76 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 77 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 78 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 79 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 80 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 81 | 2820848511 | Unclassified Actinobacteria Lab288P3bin86 | Isolate | Unclassified |
| 82 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 83 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 84 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 85 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 86 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 87 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 88 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 89 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 90 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 91 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 92 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 93 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 94 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 95 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 96 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 97 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 98 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 99 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 100 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 101 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 102 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 103 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 104 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 105 | 3300008519 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Neivamyrmex summichrasti Gut microbial communities of Neivamyrmex summichrasti | Metagenome | Formicidae |
| 106 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 107 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 108 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 109 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 110 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 111 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 112 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 113 | 2820822094 | Unclassified Actinobacteria Nt197P3bin131 | Isolate | Unclassified |
| 114 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 115 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 116 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 117 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 118 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 119 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 120 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 121 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 122 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 123 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 124 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 125 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 126 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 127 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 128 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 129 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 130 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 131 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 132 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 133 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 134 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 135 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 136 | 2820880921 | Unclassified Actinobacteria Lab288P1bin60 | Isolate | Unclassified |
| 137 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 138 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 139 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 140 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 141 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 142 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 143 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 144 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 145 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 146 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 147 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 148 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 149 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 150 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 151 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 152 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 153 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 154 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 155 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 156 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 157 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 158 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 159 | 8112490586 | Staphylococcus muscae CCM 4175 | Isolate | |
| 160 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 161 | 2917496769 | Staphylococcus muscae DSM 7068 | Isolate | Unclassified |
| 162 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 163 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 164 | 2896402965 | Weissella diestrammenae KACC 16890 | Isolate | Rhaphidophoridae |
| 165 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 166 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 167 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 168 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 169 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 170 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 171 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 172 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 173 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 174 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 175 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 176 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 177 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 178 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 179 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 180 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 181 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 182 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 183 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 184 | 3300026559 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 | Metagenome | Formicidae |
| 185 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 186 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 187 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 188 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 189 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 190 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 191 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 192 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 193 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 194 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 195 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 196 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 197 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 198 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 199 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 200 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 201 | 3300026558 | Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0325 | 3300056790 | Unclassified | 116843 |
| 2 | Ga0562374_0842 | 3300057007 | Bacteria | 43365 |
| 3 | Ga0415639_074308 | 3300038395 | Bacteria | 2471 |
| 4 | Ga0466700_014411 | 3300042600 | Bacteria | 3010 |
| 5 | Ga0466715_541400 | 3300042616 | Unclassified | 1632 |
| 6 | Ga0466734_045335 | 3300042623 | Bacteria | 3191 |
| 7 | Ga0466725_105823 | 3300042654 | Bacteria | 1404 |
| 8 | Ga0123356_10315932 | 3300010049 | Bacteria | 1673 |
| 9 | Ga0123353_10001343 | 3300010167 | Bacteria | 30161 |
| 10 | Ga0104050_1208021 | 3300007153 | Bacteria | 1092 |
| 11 | Ga0466733_031080 | 3300042659 | Bacteria | 9171 |
| 12 | Ga0562376_1810 | 3300056857 | Unclassified | 28502 |
| 13 | Ga0415639_053171 | 3300038395 | Bacteria | 13877 |
| 14 | Ga0466706_137549 | 3300042599 | Bacteria | 8681 |
| 15 | Ga0466717_041744 | 3300042604 | Bacteria | 15696 |
| 16 | Ga0466715_282602 | 3300042616 | Bacteria | 48405 |
| 17 | Ga0466704_418643 | 3300042643 | Bacteria | 2951 |
| 18 | Ga0466724_01144 | 3300042649 | Bacteria | 15535 |
| 19 | Ga0466727_142534 | 3300042655 | Bacteria | 55597 |
| 20 | Ga0123355_10217607 | 3300009826 | Bacteria | 2754 |
| 21 | Ga0123356_10000572 | 3300010049 | Bacteria | 40906 |
| 22 | Ga0123353_10045818 | 3300010167 | Bacteria | 6944 |
| 23 | Ga0123353_10936190 | 3300010167 | Unclassified | 1174 |
| 24 | Ga0123353_10978176 | 3300010167 | Bacteria | 1140 |
| 25 | Ga0068302_10156818 | 3300005071 | Bacteria | 6463 |
| 26 | Ga0072940_1147877 | 3300005200 | Bacteria | 2371 |
| 27 | Ga0530661_000024 | 3300056564 | Bacteria | 185853 |
| 28 | Ga0562378_0771 | 3300056814 | Bacteria | 44323 |
| 29 | Ga0415639_038553 | 3300038395 | Bacteria | 3339 |
| 30 | Ga0466691_004164 | 3300042593 | Bacteria | 33925 |
| 31 | Ga0466694_036923 | 3300042594 | Bacteria | 3068 |
| 32 | Ga0466706_096843 | 3300042599 | Bacteria | 3557 |
| 33 | Ga0466700_383333 | 3300042600 | Bacteria | 8804 |
| 34 | Ga0466716_300015 | 3300042605 | Bacteria | 3684 |
| 35 | Ga0466719_471935 | 3300042606 | Bacteria | 42176 |
| 36 | Ga0466723_145021 | 3300042618 | Bacteria | 26307 |
| 37 | Ga0466697_064414 | 3300042611 | Bacteria | 1886 |
| 38 | Ga0123356_10738237 | 3300010049 | Unclassified | 1154 |
| 39 | Ga0160464_100835 | 3300012805 | Bacteria | 16383 |
| 40 | 2212886494 | 2209111004 | Bacteria | 8136 |
| 41 | JGI24703J35330_11459859 | 3300002501 | Bacteria | 1046 |
| 42 | JGI24697J35500_11213521 | 3300002507 | Unclassified | 1797 |
| 43 | CVPL010L_1000369 | 3300002932 | Unclassified | 10726 |
| 44 | Ga0415639_119748 | 3300038395 | Bacteria | 1266 |
| 45 | Ga0466656_252214 | 3300042550 | Bacteria | 1128 |
| 46 | Ga0466695_319579 | 3300042595 | Bacteria | 1338 |
| 47 | Ga0466701_101169 | 3300042598 | Bacteria | 66668 |
| 48 | Ga0466707_089502 | 3300042601 | Bacteria | 12032 |
| 49 | Ga0466719_084719 | 3300042606 | Bacteria | 20043 |
| 50 | Ga0466710_319995 | 3300042613 | Bacteria | 1337 |
| 51 | Ga0466715_586554 | 3300042616 | Bacteria | 2830 |
| 52 | Ga0466726_064906 | 3300042619 | Bacteria | 72682 |
| 53 | Ga0466726_186614 | 3300042619 | Bacteria | 12966 |
| 54 | Ga0466728_333581 | 3300042620 | Bacteria | 2672 |
| 55 | Ga0466728_409986 | 3300042620 | Bacteria | 12278 |
| 56 | Ga0466734_075033 | 3300042623 | Bacteria | 4664 |
| 57 | Ga0466730_044605 | 3300042625 | Bacteria | 3445 |
| 58 | Ga0466724_48958 | 3300042649 | Bacteria | 1228 |
| 59 | Ga0123355_10033229 | 3300009826 | Bacteria | 8378 |
| 60 | Ga0123356_11220452 | 3300010049 | Bacteria | 918 |
| 61 | 2227480184 | 2225789004 | Bacteria | 78831 |
| 62 | 2227563513 | 2225789004 | Bacteria | 51011 |
| 63 | JGI24702J35022_10019717 | 3300002462 | Bacteria | 3667 |
| 64 | JGI24696J40584_12957527 | 3300002834 | Bacteria | 3561 |
| 65 | Ga0068302_10015215 | 3300005071 | Bacteria | 43393 |
| 66 | Ga0072941_1418630 | 3300005201 | Bacteria | 1400 |
| 67 | Ga0104019_1004266 | 3300007150 | Bacteria | 2758 |
| 68 | Ga0562379_0681 | 3300056790 | Unclassified | 57878 |
| 69 | Ga0562376_1714 | 3300056857 | Unclassified | 29495 |
| 70 | Ga0264413_162424 | 3300024493 | Bacteria | 1054 |
| 71 | Ga0255576_1000225 | 3300026558 | Bacteria | 43604 |
| 72 | Ga0466696_257695 | 3300042596 | Bacteria | 8158 |
| 73 | Ga0466707_262781 | 3300042601 | Bacteria | 9047 |
| 74 | Ga0466707_278592 | 3300042601 | Bacteria | 154108 |
| 75 | Ga0466719_522406 | 3300042606 | Bacteria | 1563 |
| 76 | Ga0466719_523800 | 3300042606 | Bacteria | 8558 |
| 77 | Ga0466722_236472 | 3300042609 | Bacteria | 4584 |
| 78 | Ga0466715_042181 | 3300042616 | Bacteria | 63725 |
| 79 | Ga0466726_065279 | 3300042619 | Bacteria | 58452 |
| 80 | Ga0123355_10068135 | 3300009826 | Bacteria | 5726 |
| 81 | Ga0123355_10714063 | 3300009826 | Bacteria | 1146 |
| 82 | Ga0123353_10002158 | 3300010167 | Bacteria | 24325 |
| 83 | Ga0562379_0017 | 3300056790 | Bacteria | 1147482 |
| 84 | Ga0562379_0748 | 3300056790 | Bacteria | 54170 |
| 85 | Ga0562374_0016 | 3300057007 | Bacteria | 1205025 |
| 86 | Ga0160447_112318 | 3300012849 | Bacteria | 1749 |
| 87 | Ga0255575_1000917 | 3300026559 | Bacteria | 49164 |
| 88 | Ga0466690_169890 | 3300042590 | Bacteria | 4819 |
| 89 | Ga0466696_002326 | 3300042596 | Bacteria | 16543 |
| 90 | Ga0466706_021240 | 3300042599 | Bacteria | 6844 |
| 91 | Ga0466707_162390 | 3300042601 | Bacteria | 63505 |
| 92 | Ga0466715_087514 | 3300042616 | Bacteria | 35967 |
| 93 | Ga0466734_014796 | 3300042623 | Bacteria | 12704 |
| 94 | Ga0466708_181389 | 3300042652 | Bacteria | 30464 |
| 95 | Ga0123355_10000636 | 3300009826 | Bacteria | 47516 |
| 96 | Ga0123355_10764848 | 3300009826 | Unclassified | 1088 |
| 97 | Ga0123353_10638856 | 3300010167 | Bacteria | 1510 |
| 98 | Ga0123353_11135869 | 3300010167 | Bacteria | 1033 |
| 99 | Ga0123354_10287963 | 3300010882 | Bacteria | 1580 |
| 100 | Ga0160466_100221 | 3300012809 | Bacteria | 40944 |
| 101 | JGI24702J35022_10071885 | 3300002462 | Bacteria | 1864 |
| 102 | JGI24702J35022_10121017 | 3300002462 | Unclassified | 1446 |
| 103 | JGI24703J35330_11748295 | 3300002501 | Bacteria | 13391 |
| 104 | JGI24705J35276_12068452 | 3300002504 | Unclassified | 949 |
| 105 | JGI24705J35276_12210132 | 3300002504 | Bacteria | 1816 |
| 106 | Ga0104041_1117967 | 3300007106 | Bacteria | 1167 |
| 107 | Ga0105005_1021358 | 3300007505 | Bacteria | 7935 |
| 108 | Ga0111035_102935 | 3300007901 | Bacteria | 18284 |
| 109 | Ga0111037_112856 | 3300008519 | Bacteria | 3289 |
| 110 | Ga0530661_000022 | 3300056564 | Bacteria | 194089 |
| 111 | Ga0562379_0049 | 3300056790 | Bacteria | 522222 |
| 112 | Ga0562377_0019 | 3300056842 | Bacteria | 1067000 |
| 113 | Ga0562375_1666 | 3300056856 | Bacteria | 28581 |
| 114 | Ga0160455_100724 | 3300012837 | Bacteria | 13510 |
| 115 | Ga0247289_1385 | 3300035363 | Bacteria | 2276 |
| 116 | Ga0466693_276524 | 3300042592 | Bacteria | 1412 |
| 117 | Ga0466713_117047 | 3300042602 | Bacteria | 144191 |
| 118 | Ga0466719_285681 | 3300042606 | Unclassified | 2411 |
| 119 | Ga0466715_055478 | 3300042616 | Bacteria | 27402 |
| 120 | Ga0466715_247075 | 3300042616 | Bacteria | 1692 |
| 121 | Ga0466728_046430 | 3300042620 | Bacteria | 43059 |
| 122 | Ga0466729_207820 | 3300042621 | Bacteria | 11852 |
| 123 | Ga0466709_209507 | 3300042648 | Bacteria | 6668 |
| 124 | Ga0123353_10102044 | 3300010167 | Bacteria | 4624 |
| 125 | JGI24705J35276_12235773 | 3300002504 | Bacteria | 6966 |
| 126 | JGI24696J40584_12940291 | 3300002834 | Bacteria | 1674 |
| 127 | Ga0063521_1000130 | 3300003973 | Bacteria | 58438 |
| 128 | Ga0562379_1612 | 3300056790 | Bacteria | 24409 |
| 129 | Ga0562379_4537 | 3300056790 | Bacteria | 6819 |
| 130 | Ga0562377_0208 | 3300056842 | Bacteria | 150977 |
| 131 | Ga0562375_0025 | 3300056856 | Bacteria | 749171 |
| 132 | Ga0255572_1006710 | 3300026175 | Bacteria | 3609 |
| 133 | Ga0466696_117413 | 3300042596 | Bacteria | 28050 |
| 134 | Ga0466707_157037 | 3300042601 | Bacteria | 1044 |
| 135 | Ga0466722_153161 | 3300042609 | Bacteria | 4267 |
| 136 | Ga0466729_091910 | 3300042621 | Bacteria | 1819 |
| 137 | Ga0466705_110843 | 3300042612 | Bacteria | 6347 |
| 138 | Ga0466734_109007 | 3300042623 | Bacteria | 5083 |
| 139 | Ga0466703_106684 | 3300042636 | Bacteria | 7252 |
| 140 | Ga0466704_327441 | 3300042643 | Bacteria | 6271 |
| 141 | Ga0466704_484062 | 3300042643 | Bacteria | 4228 |
| 142 | Ga0466704_571957 | 3300042643 | Bacteria | 15856 |
| 143 | Ga0123356_10292056 | 3300010049 | Bacteria | 1731 |
| 144 | IMNBL1DRAFT_c0002846 | 3300000062 | Bacteria | 11633 |
| 145 | AustNasuHG_c1004718 | 3300000089 | Unclassified | 4884 |
| 146 | JGI24702J35022_10010328 | 3300002462 | Bacteria | 5218 |
| 147 | Ga0068302_10013086 | 3300005071 | Bacteria | 7814 |
| 148 | Ga0068305_10216088 | 3300005083 | Bacteria | 2120 |
| 149 | Ga0072940_1195002 | 3300005200 | Unclassified | 1516 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00687 | Ribosomal_L1 | Ribosomal protein L1p/L10e family | 25 | 200 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.