Protein Family IF03746
Metagenome
Isolate
292
Members
149
Samples
230
Scaffolds
416.95
Avg Length
Representative Sequence
- ID
- 3300012829|Ga0160467_100248|Ga0160467_10024818
- Length
- 461 aa
- Sequence
- VLNRKGGNEQFCLINDRIKIVNKTNLSKFVSLKIHTIMLQLNYIRENRDKVIERLGVKNFKEIGLVDEIITLDEQRRKIQSESDALSAEANSSAKKIGELMRQGKKEEAEAVKSQSSGYKEQIKSLTDHLDRVEQDLNAKIVQLPNLPHTTVPAGVSADDNEVVLENGTIPTLADDAVSHWDLLTKYGIVDLELGVKVTGAGFPVYKGKGARLQRALINFFLDEAAKVGYEEVQVPIMVNEASAFATGQLPDKEGQMYHVTHDDLYLIPTAEVPVTNIYRDVIVKEEQFPIRHCAYTPCFRREAGSYGAHVRGLNRLHQFDKVETVQIVHPDRSYDALEEMNTYVQGLLQKLELPYRVLRLCGGDMSFTAALTYDLEVYSAAQKRWLEVSSVSNFETYQSNRLKVRFKNQDGKMQLAHTLNGSALALPRIVASLLENNQTDKGIKIPKVLVPYTGFEYID*
Sample Types
Isolate
21.2%
Metagenome
78.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
20.9%
Unclassified
14.2%
Blattidae
12.7%
Kalotermitidae
9.7%
Formicidae
5.2%
Armadillidiidae
4.5%
Apidae
3.7%
Rhinotermitidae
3.7%
Culicidae
3.0%
Passalidae
3.0%
Elmidae
3.0%
Hydrophilidae
2.2%
Drosophilidae
2.2%
Termopsidae
2.2%
Daphniidae
1.5%
Tenebrionidae
1.5%
Aphididae
0.7%
Pyroglyphidae
0.7%
Aphelinidae
0.7%
Bombycidae
0.7%
Kiwaidae
0.7%
Cambaridae
0.7%
Delphacidae
0.7%
Hodotermitidae
0.7%
Nephropidae
0.7%
Taxonomy
Archaea
0
Bacteria
288
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 2 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 3 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 4 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 5 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 6 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 13 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 14 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 15 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 16 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 17 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 18 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 19 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 20 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 25 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 26 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 27 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 28 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 29 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 30 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 31 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 32 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 33 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 34 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 35 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 40 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 41 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 44 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 45 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 46 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 47 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 48 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 49 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 50 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 51 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 52 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 53 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 54 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 55 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 58 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 59 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 60 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 61 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 62 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 63 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 64 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 65 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 66 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 67 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 68 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 69 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 70 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 71 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 72 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 73 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 74 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 75 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 76 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 77 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 78 | 3000153175 | Cardinium endosymbiont of Dermatophagoides farinae UMMZ BMOC 05-0812-001 | Isolate | Pyroglyphidae |
| 79 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 80 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 81 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 82 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 83 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 84 | 3300003131 | Encarsia pergandiella symbiont microbial communities from Weslaco, Texas | Metagenome | Aphelinidae |
| 85 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 86 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 87 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 88 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 89 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 90 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 91 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 92 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 93 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 94 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 95 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 96 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 97 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 98 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 99 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 100 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 101 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 102 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 103 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 104 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 105 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 106 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 107 | 3000336795 | Cardinium endosymbiont of Sogatella furcifera cSfur | Isolate | Delphacidae |
| 108 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 109 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 110 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 111 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 112 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 113 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 114 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 115 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 116 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 117 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 118 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 119 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 120 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 121 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 122 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 123 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 124 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 125 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 126 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 127 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 128 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 129 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 130 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 131 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 132 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 133 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 134 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 135 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 136 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 137 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 138 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 139 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 140 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 141 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 142 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 143 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 144 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 145 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 146 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 147 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 148 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 149 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_134143 | 3300042659 | Bacteria | 2235 |
| 2 | Ga0466733_194732 | 3300042659 | Bacteria | 3551 |
| 3 | Ga0466706_023664 | 3300042599 | Bacteria | 49263 |
| 4 | Ga0466706_036645 | 3300042599 | Bacteria | 3497 |
| 5 | Ga0466706_104443 | 3300042599 | Bacteria | 12483 |
| 6 | Ga0466706_141992 | 3300042599 | Bacteria | 60260 |
| 7 | Ga0466707_394110 | 3300042601 | Bacteria | 20693 |
| 8 | Ga0466722_190847 | 3300042609 | Bacteria | 33466 |
| 9 | Ga0466722_263274 | 3300042609 | Bacteria | 17083 |
| 10 | Ga0160453_100255 | 3300012814 | Bacteria | 51887 |
| 11 | Ga0160447_100006 | 3300012849 | Bacteria | 523520 |
| 12 | Ga0157631_128256 | 3300013007 | Bacteria | 5615 |
| 13 | Ga0264413_160094 | 3300024493 | Bacteria | 1867 |
| 14 | Ga0466690_218264 | 3300042590 | Bacteria | 18957 |
| 15 | Ga0466696_103112 | 3300042596 | Bacteria | 3617 |
| 16 | Ga0466699_117325 | 3300042597 | Bacteria | 3456 |
| 17 | Ga0466729_235356 | 3300042621 | Bacteria | 7488 |
| 18 | Ga0466729_296569 | 3300042621 | Bacteria | 3872 |
| 19 | Ga0466734_119570 | 3300042623 | Bacteria | 1949 |
| 20 | Ga0466703_017812 | 3300042636 | Bacteria | 2358 |
| 21 | Ga0466703_264690 | 3300042636 | Bacteria | 7503 |
| 22 | Ga0466704_316152 | 3300042643 | Bacteria | 27672 |
| 23 | Ga0466724_41267 | 3300042649 | Bacteria | 4756 |
| 24 | Ga0466724_61209 | 3300042649 | Bacteria | 46468 |
| 25 | Ga0466708_047168 | 3300042652 | Bacteria | 38721 |
| 26 | Ga0466708_188840 | 3300042652 | Bacteria | 10953 |
| 27 | Ga0466727_139559 | 3300042655 | Bacteria | 7534 |
| 28 | Ga0466705_528133 | 3300042612 | Bacteria | 23688 |
| 29 | Ga0466711_335669 | 3300042615 | Bacteria | 37569 |
| 30 | Ga0466728_082257 | 3300042620 | Bacteria | 106309 |
| 31 | 2227300238 | 2225789004 | Bacteria | 6607 |
| 32 | JGI24702J35022_10005902 | 3300002462 | Bacteria | 7119 |
| 33 | Ga0103267_1000141 | 3300007190 | Bacteria | 30888 |
| 34 | Ga0123353_10031639 | 3300010167 | Bacteria | 8199 |
| 35 | Ga0160454_100027 | 3300012798 | Bacteria | 281188 |
| 36 | Ga0466705_384768 | 3300042612 | Bacteria | 8548 |
| 37 | Ga0466733_053801 | 3300042659 | Bacteria | 13129 |
| 38 | Ga0466733_099961 | 3300042659 | Bacteria | 6831 |
| 39 | Ga0466706_176975 | 3300042599 | Bacteria | 27553 |
| 40 | Ga0466707_284882 | 3300042601 | Bacteria | 17288 |
| 41 | Ga0466716_108191 | 3300042605 | Bacteria | 8483 |
| 42 | Ga0160469_100013 | 3300012824 | Bacteria | 444998 |
| 43 | Ga0160445_100784 | 3300012847 | Bacteria | 11978 |
| 44 | Ga0415639_177156 | 3300038395 | Bacteria | 1609 |
| 45 | Ga0466692_155859 | 3300042591 | Bacteria | 17714 |
| 46 | Ga0466701_002464 | 3300042598 | Bacteria | 3368 |
| 47 | Ga0466703_322755 | 3300042636 | Bacteria | 21047 |
| 48 | Ga0466724_00918 | 3300042649 | Bacteria | 46721 |
| 49 | Ga0466711_400416 | 3300042615 | Bacteria | 12160 |
| 50 | Ga0466726_238283 | 3300042619 | Bacteria | 1608 |
| 51 | 2227080801 | 2225789004 | Bacteria | 40926 |
| 52 | JGI24702J35022_10011067 | 3300002462 | Bacteria | 5026 |
| 53 | Ga0102735_1000137 | 3300007080 | Bacteria | 18922 |
| 54 | Ga0102737_1000010 | 3300007142 | Bacteria | 59215 |
| 55 | Ga0123355_10000003 | 3300009826 | Bacteria | 224088 |
| 56 | Ga0466701_021588 | 3300042598 | Bacteria | 47878 |
| 57 | Ga0466706_112878 | 3300042599 | Bacteria | 18095 |
| 58 | Ga0466706_166086 | 3300042599 | Bacteria | 38734 |
| 59 | Ga0466700_416655 | 3300042600 | Bacteria | 17402 |
| 60 | Ga0160467_100181 | 3300012829 | Bacteria | 86124 |
| 61 | Ga0160445_100325 | 3300012847 | Bacteria | 28697 |
| 62 | Ga0265387_1001873 | 3300024582 | Bacteria | 3003 |
| 63 | Ga0466696_327292 | 3300042596 | Bacteria | 13352 |
| 64 | Ga0466729_217598 | 3300042621 | Bacteria | 2948 |
| 65 | Ga0466729_296520 | 3300042621 | Bacteria | 9735 |
| 66 | Ga0466731_336997 | 3300042622 | Bacteria | 40948 |
| 67 | Ga0466704_481288 | 3300042643 | Bacteria | 19956 |
| 68 | Ga0466723_086519 | 3300042618 | Bacteria | 25074 |
| 69 | JGI24695J34938_10074771 | 3300002450 | Bacteria | 1409 |
| 70 | JGI24702J35022_10009705 | 3300002462 | Bacteria | 5399 |
| 71 | Ga0068305_10016620 | 3300005083 | Bacteria | 2476 |
| 72 | Ga0072941_1028824 | 3300005201 | Bacteria | 5262 |
| 73 | Ga0102740_1000098 | 3300007140 | Bacteria | 21610 |
| 74 | Ga0123357_10046829 | 3300009784 | Bacteria | 5864 |
| 75 | Ga0123353_10003231 | 3300010167 | Bacteria | 20536 |
| 76 | Ga0123354_10001016 | 3300010882 | Bacteria | 32074 |
| 77 | Ga0466705_154286 | 3300042612 | Bacteria | 18943 |
| 78 | Ga0466732_175565 | 3300042656 | Bacteria | 5358 |
| 79 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 80 | Ga0466706_025836 | 3300042599 | Bacteria | 18233 |
| 81 | Ga0466706_107334 | 3300042599 | Bacteria | 17627 |
| 82 | Ga0466713_008208 | 3300042602 | Bacteria | 15690 |
| 83 | Ga0466721_149539 | 3300042608 | Bacteria | 2583 |
| 84 | Ga0466722_177733 | 3300042609 | Bacteria | 16531 |
| 85 | Ga0160467_100072 | 3300012829 | Bacteria | 152638 |
| 86 | Ga0160467_100248 | 3300012829 | Bacteria | 66505 |
| 87 | Ga0160443_100028 | 3300012848 | Bacteria | 368417 |
| 88 | Ga0160457_1000536 | 3300012858 | Bacteria | 16111 |
| 89 | Ga0466657_271110 | 3300042582 | Bacteria | 2740 |
| 90 | Ga0466657_363639 | 3300042582 | Bacteria | 11379 |
| 91 | Ga0466690_035097 | 3300042590 | Bacteria | 7898 |
| 92 | Ga0466690_118535 | 3300042590 | Bacteria | 11335 |
| 93 | Ga0466690_170801 | 3300042590 | Bacteria | 10555 |
| 94 | Ga0466692_127794 | 3300042591 | Bacteria | 5623 |
| 95 | Ga0466731_043145 | 3300042622 | Bacteria | 2923 |
| 96 | Ga0466724_28891 | 3300042649 | Bacteria | 455231 |
| 97 | Ga0466708_313602 | 3300042652 | Bacteria | 27720 |
| 98 | Ga0466710_104711 | 3300042613 | Bacteria | 1457 |
| 99 | Ga0466711_208704 | 3300042615 | Bacteria | 7773 |
| 100 | Ga0466715_139469 | 3300042616 | Bacteria | 1899 |
| 101 | Ga0466715_147559 | 3300042616 | Bacteria | 7945 |
| 102 | 2226980392 | 2225789003 | Bacteria | 9223 |
| 103 | HBC_ctgsDRAFT_1000005 | 3300000333 | Bacteria | 62596 |
| 104 | JGI24702J35022_10001375 | 3300002462 | Bacteria | 15103 |
| 105 | Ga0102734_1000152 | 3300007129 | Bacteria | 30183 |
| 106 | Ga0123357_10092931 | 3300009784 | Bacteria | 3923 |
| 107 | Ga0123357_10229400 | 3300009784 | Bacteria | 2039 |
| 108 | Ga0123355_10001635 | 3300009826 | Bacteria | 31262 |
| 109 | Ga0123355_10073062 | 3300009826 | Bacteria | 5499 |
| 110 | Ga0123353_10000014 | 3300010167 | Bacteria | 204767 |
| 111 | Ga0123353_10359660 | 3300010167 | Bacteria | 2188 |
| 112 | Ga0466705_295185 | 3300042612 | Bacteria | 3791 |
| 113 | Ga0466701_026886 | 3300042598 | Bacteria | 2176 |
| 114 | Ga0466706_002764 | 3300042599 | Bacteria | 6869 |
| 115 | Ga0466706_180584 | 3300042599 | Bacteria | 35920 |
| 116 | Ga0466706_246163 | 3300042599 | Bacteria | 20466 |
| 117 | Ga0466713_121587 | 3300042602 | Bacteria | 21118 |
| 118 | Ga0466714_065131 | 3300042603 | Bacteria | 171349 |
| 119 | Ga0466716_181049 | 3300042605 | Bacteria | 16159 |
| 120 | Ga0466719_448992 | 3300042606 | Bacteria | 5270 |
| 121 | Ga0466722_054620 | 3300042609 | Bacteria | 8464 |
| 122 | Ga0160458_100063 | 3300012832 | Bacteria | 137674 |
| 123 | Ga0160452_102952 | 3300012834 | Bacteria | 3237 |
| 124 | Ga0160445_102958 | 3300012847 | Unclassified | 3635 |
| 125 | Ga0466692_110825 | 3300042591 | Bacteria | 2211 |
| 126 | Ga0466694_078292 | 3300042594 | Bacteria | 4289 |
| 127 | Ga0466724_40742 | 3300042649 | Bacteria | 1894 |
| 128 | Ga0466727_263308 | 3300042655 | Bacteria | 66130 |
| 129 | Ga0466711_481586 | 3300042615 | Bacteria | 4075 |
| 130 | Ga0466715_471954 | 3300042616 | Bacteria | 11673 |
| 131 | Ga0466726_271705 | 3300042619 | Bacteria | 2189 |
| 132 | 2227044269 | 2225789003 | Bacteria | 4075 |
| 133 | IMNBL1DRAFT_c0000168 | 3300000062 | Bacteria | 58839 |
| 134 | JGI24705J35276_12227756 | 3300002504 | Bacteria | 3057 |
| 135 | JGI24696J40584_12961705 | 3300002834 | Bacteria | 42529 |
| 136 | Ga0052165_100034 | 3300003131 | Bacteria | 12069 |
| 137 | Ga0104045_1001879 | 3300007085 | Bacteria | 4922 |
| 138 | Ga0104045_1075732 | 3300007085 | Bacteria | 1840 |
| 139 | Ga0104048_1001511 | 3300007143 | Unclassified | 4668 |
| 140 | Ga0104019_1189767 | 3300007150 | Unclassified | 4194 |
| 141 | Ga0123357_10007479 | 3300009784 | Bacteria | 13506 |
| 142 | Ga0123356_10001474 | 3300010049 | Bacteria | 25944 |
| 143 | Ga0123356_10045620 | 3300010049 | Bacteria | 4078 |
| 144 | Ga0466705_194821 | 3300042612 | Bacteria | 15623 |
| 145 | Ga0466733_217517 | 3300042659 | Bacteria | 12455 |
| 146 | Ga0466701_086544 | 3300042598 | Bacteria | 103634 |
| 147 | Ga0466706_115665 | 3300042599 | Bacteria | 6532 |
| 148 | Ga0466706_138302 | 3300042599 | Unclassified | 2583 |
| 149 | Ga0466706_215383 | 3300042599 | Bacteria | 1727 |
| 150 | Ga0466706_263045 | 3300042599 | Bacteria | 5752 |
| 151 | Ga0466713_023468 | 3300042602 | Bacteria | 115789 |
| 152 | Ga0466719_259708 | 3300042606 | Bacteria | 13010 |
| 153 | Ga0466719_292258 | 3300042606 | Bacteria | 3088 |
| 154 | Ga0466722_189577 | 3300042609 | Bacteria | 4568 |
| 155 | Ga0160434_100235 | 3300012850 | Bacteria | 23458 |
| 156 | Ga0466691_001983 | 3300042593 | Bacteria | 3214 |
| 157 | Ga0466704_280399 | 3300042643 | Bacteria | 59189 |
| 158 | Ga0466710_024292 | 3300042613 | Bacteria | 3750 |
| 159 | Ga0466710_191023 | 3300042613 | Bacteria | 3644 |
| 160 | Ga0466711_287258 | 3300042615 | Bacteria | 26616 |
| 161 | Ga0466715_201011 | 3300042616 | Bacteria | 16240 |
| 162 | Ga0466718_081528 | 3300042617 | Bacteria | 1726 |
| 163 | Ga0466723_233824 | 3300042618 | Bacteria | 4389 |
| 164 | Ga0466729_053291 | 3300042621 | Bacteria | 1693 |
| 165 | IMNBL1DRAFT_c0003234 | 3300000062 | Bacteria | 10646 |
| 166 | JGI24699J35502_11133978 | 3300002509 | Bacteria | 22406 |
| 167 | Ga0104048_1001674 | 3300007143 | Bacteria | 15069 |
| 168 | Ga0123353_10002366 | 3300010167 | Bacteria | 23421 |
| 169 | Ga0123353_10004432 | 3300010167 | Bacteria | 18082 |
| 170 | Ga0123354_10053229 | 3300010882 | Bacteria | 6088 |
| 171 | Ga0160465_100328 | 3300012803 | Bacteria | 28159 |
| 172 | Ga0466733_048665 | 3300042659 | Bacteria | 27056 |
| 173 | Ga0466733_051738 | 3300042659 | Bacteria | 2431 |
| 174 | Ga0466733_165496 | 3300042659 | Bacteria | 147790 |
| 175 | Ga0466701_031730 | 3300042598 | Bacteria | 202867 |
| 176 | Ga0466701_097127 | 3300042598 | Bacteria | 5038 |
| 177 | Ga0466706_011215 | 3300042599 | Bacteria | 27480 |
| 178 | Ga0466706_053989 | 3300042599 | Bacteria | 17416 |
| 179 | Ga0466713_025872 | 3300042602 | Bacteria | 7628 |
| 180 | Ga0466713_064041 | 3300042602 | Bacteria | 54434 |
| 181 | Ga0466713_155603 | 3300042602 | Bacteria | 10269 |
| 182 | Ga0466714_129115 | 3300042603 | Bacteria | 5220 |
| 183 | Ga0466698_187180 | 3300042610 | Bacteria | 1700 |
| 184 | Ga0466697_004001 | 3300042611 | Bacteria | 4539 |
| 185 | Ga0160431_100784 | 3300012828 | Bacteria | 10619 |
| 186 | Ga0160472_100040 | 3300012839 | Bacteria | 228958 |
| 187 | Ga0265387_1003812 | 3300024582 | Bacteria | 2072 |
| 188 | Ga0466691_129459 | 3300042593 | Bacteria | 115763 |
| 189 | Ga0466694_051792 | 3300042594 | Bacteria | 23896 |
| 190 | Ga0466703_251310 | 3300042636 | Bacteria | 38401 |
| 191 | Ga0466724_46543 | 3300042649 | Bacteria | 311178 |
| 192 | Ga0466710_198423 | 3300042613 | Bacteria | 3170 |
| 193 | Ga0466711_379326 | 3300042615 | Bacteria | 15263 |
| 194 | 2227136350 | 2225789004 | Bacteria | 37050 |
| 195 | 2227391919 | 2225789004 | Bacteria | 5853 |
| 196 | IMNBGM34_c000013 | 3300000036 | Bacteria | 51275 |
| 197 | IMNBL1DRAFT_c0001288 | 3300000062 | Bacteria | 18888 |
| 198 | Ga0103265_1000877 | 3300007068 | Bacteria | 5005 |
| 199 | Ga0123356_10109761 | 3300010049 | Bacteria | 2662 |
| 200 | Ga0123353_10152727 | 3300010167 | Bacteria | 3684 |
| 201 | Ga0466733_019878 | 3300042659 | Bacteria | 16830 |
| 202 | Ga0466701_082893 | 3300042598 | Bacteria | 37923 |
| 203 | Ga0466706_058258 | 3300042599 | Bacteria | 2371 |
| 204 | Ga0466706_124505 | 3300042599 | Bacteria | 42262 |
| 205 | Ga0466700_309017 | 3300042600 | Bacteria | 3995 |
| 206 | Ga0466698_133733 | 3300042610 | Bacteria | 3394 |
| 207 | Ga0160433_100128 | 3300012846 | Bacteria | 68674 |
| 208 | Ga0160433_100191 | 3300012846 | Bacteria | 50072 |
| 209 | Ga0466657_182735 | 3300042582 | Bacteria | 91898 |
| 210 | Ga0466695_221633 | 3300042595 | Bacteria | 1695 |
| 211 | Ga0466735_024891 | 3300042624 | Bacteria | 20434 |
| 212 | Ga0466735_167579 | 3300042624 | Bacteria | 6447 |
| 213 | Ga0466724_24857 | 3300042649 | Bacteria | 19395 |
| 214 | Ga0466705_467594 | 3300042612 | Bacteria | 6333 |
| 215 | Ga0466710_017247 | 3300042613 | Bacteria | 3730 |
| 216 | Ga0466710_039174 | 3300042613 | Bacteria | 1502 |
| 217 | Ga0466710_167340 | 3300042613 | Bacteria | 3084 |
| 218 | Ga0466715_629769 | 3300042616 | Bacteria | 55391 |
| 219 | Ga0466723_228061 | 3300042618 | Bacteria | 41593 |
| 220 | Ga0466723_354982 | 3300042618 | Bacteria | 8959 |
| 221 | Ga0466726_123595 | 3300042619 | Bacteria | 23616 |
| 222 | JGI24696J40584_12961226 | 3300002834 | Bacteria | 12327 |
| 223 | CVPL010W_10002448 | 3300002931 | Bacteria | 23446 |
| 224 | CVPL010W_10003663 | 3300002931 | Bacteria | 17633 |
| 225 | Ga0104019_1001186 | 3300007150 | Bacteria | 12888 |
| 226 | Ga0123353_10298044 | 3300010167 | Bacteria | 2463 |
| 227 | Ga0123354_10001525 | 3300010882 | Bacteria | 28373 |
| 228 | Ga0123354_10001798 | 3300010882 | Bacteria | 27042 |
| 229 | Ga0123354_10020333 | 3300010882 | Bacteria | 10440 |
| 230 | Ga0123354_10096890 | 3300010882 | Bacteria | 4025 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.