Protein Family IF03643
Metagenome
Isolate
166
Members
105
Samples
126
Scaffolds
274.4
Avg Length
Representative Sequence
- ID
- 3300012813|Ga0160470_100097|Ga0160470_10009710
- Length
- 307 aa
- Sequence
- LRGINSQAECKNVLKNINGACPRASLLGGLMDLWTAFQALILGVVEGLTEFLPISSTGHQIIVADLLNFGGERAMAFNIIIQLGAILAVVWEFRRKILDVVIGLPTQPSARRFTANLLIAFMPAVVLGVIFADMIKEYLFNPITVATALVIGGVIMLWAERREHEVHAETVDEITWKDALKVGFAQCLAMIPGTSRSGSTIIGGLLFGLSRKTATEFSFFLAMPTMVGAAVYSGYKYRHLFVPADFPVFAVGFVTAFIFAMIAVRGLLKFIASHSYAVFAWYRIAFGLVILATWQFGWVDWSAAKP*
Sample Types
Isolate
24.1%
Metagenome
75.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Formicidae
22.1%
Unclassified
12.6%
Culicidae
11.6%
Curculionidae
10.5%
Elmidae
10.5%
Kalotermitidae
8.4%
Armadillidiidae
7.4%
Termitidae
6.3%
Drosophilidae
3.2%
Pediculidae
1.1%
Crambidae
1.1%
Muscidae
1.1%
Trigoniulidae
1.1%
Termopsidae
1.1%
Daphniidae
1.1%
Siricidae
1.1%
Taxonomy
Archaea
0
Bacteria
152
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 2 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 3 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 4 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 5 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 6 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 9 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 10 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 11 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 12 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 13 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 14 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 15 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 16 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 17 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 18 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 19 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 20 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 21 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 22 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 23 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 24 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 25 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 26 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 27 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 28 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 29 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 35 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 36 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 37 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 38 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 39 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 40 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 41 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 42 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 43 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 44 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 45 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 46 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 47 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 52 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 53 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 54 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 55 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 56 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 57 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 58 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 59 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 60 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 61 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 62 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 63 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 64 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 65 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 66 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 67 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 68 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 69 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 70 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 71 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 72 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 73 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 74 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 75 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 76 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 77 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 78 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 79 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 80 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 81 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 82 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 83 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 84 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 85 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 86 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 87 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 88 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 89 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 90 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 91 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 92 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 93 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 94 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 95 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 96 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 97 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 98 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 99 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 100 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 101 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 102 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 103 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 104 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 105 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160442_100202 | 3300012806 | Bacteria | 48783 |
| 2 | Ga0160442_101240 | 3300012806 | Bacteria | 3208 |
| 3 | Ga0466710_021228 | 3300042613 | Bacteria | 41506 |
| 4 | Ga0466701_068459 | 3300042598 | Bacteria | 84853 |
| 5 | DPO_contig08572 | 2032320009 | Bacteria | 9048 |
| 6 | CVPL010W_10000001 | 3300002931 | Bacteria | 135542 |
| 7 | Ga0102736_1004219 | 3300007052 | Bacteria | 1964 |
| 8 | Ga0103266_1000037 | 3300007067 | Bacteria | 62036 |
| 9 | Ga0103261_1001235 | 3300007083 | Bacteria | 5762 |
| 10 | Ga0104045_1027356 | 3300007085 | Unclassified | 3705 |
| 11 | Ga0103264_1000214 | 3300007188 | Bacteria | 35666 |
| 12 | Ga0466724_21268 | 3300042649 | Bacteria | 310861 |
| 13 | Ga0466724_61852 | 3300042649 | Bacteria | 69449 |
| 14 | CVPL010L_1000085 | 3300002932 | Bacteria | 29304 |
| 15 | CVPL005W_1000190 | 3300002934 | Bacteria | 46374 |
| 16 | Ga0063521_1000896 | 3300003973 | Bacteria | 9961 |
| 17 | Ga0102736_1000405 | 3300007052 | Bacteria | 20273 |
| 18 | Ga0103266_1000016 | 3300007067 | Bacteria | 168522 |
| 19 | Ga0102738_1003076 | 3300007141 | Bacteria | 2462 |
| 20 | Ga0102737_1000158 | 3300007142 | Bacteria | 42980 |
| 21 | Ga0102737_1001160 | 3300007142 | Bacteria | 7686 |
| 22 | Ga0102737_1006204 | 3300007142 | Bacteria | 2301 |
| 23 | Ga0103264_1000074 | 3300007188 | Bacteria | 59111 |
| 24 | Ga0103264_1002593 | 3300007188 | Bacteria | 9227 |
| 25 | Ga0127649_102006 | 3300009460 | Bacteria | 64915 |
| 26 | Ga0466734_045579 | 3300042623 | Bacteria | 27699 |
| 27 | Ga0466730_007658 | 3300042625 | Bacteria | 32338 |
| 28 | Ga0160467_101786 | 3300012829 | Unclassified | 6722 |
| 29 | Ga0160446_100061 | 3300012835 | Bacteria | 112383 |
| 30 | Ga0160455_100993 | 3300012837 | Bacteria | 10222 |
| 31 | Ga0160436_1010737 | 3300012861 | Bacteria | 1984 |
| 32 | Ga0316159_10039 | 3300030930 | Bacteria | 23658 |
| 33 | Ga0466723_050496 | 3300042618 | Bacteria | 21730 |
| 34 | Ga0466726_105366 | 3300042619 | Bacteria | 1381 |
| 35 | Ga0466713_130829 | 3300042602 | Bacteria | 17811 |
| 36 | SWWA_contig04375__length_38483___numreads_1820 | 2100351016 | Bacteria | 38483 |
| 37 | CVPL005W_1002147 | 3300002934 | Bacteria | 4171 |
| 38 | Ga0103266_1000896 | 3300007067 | Bacteria | 8939 |
| 39 | Ga0103266_1002903 | 3300007067 | Bacteria | 2554 |
| 40 | Ga0103265_1000483 | 3300007068 | Bacteria | 6722 |
| 41 | Ga0102735_1000205 | 3300007080 | Bacteria | 15180 |
| 42 | Ga0102735_1002790 | 3300007080 | Bacteria | 2554 |
| 43 | Ga0104045_1019717 | 3300007085 | Bacteria | 3077 |
| 44 | Ga0103260_1002670 | 3300007139 | Unclassified | 2976 |
| 45 | Ga0103264_1000257 | 3300007188 | Bacteria | 29635 |
| 46 | Ga0103264_1000723 | 3300007188 | Bacteria | 15903 |
| 47 | Ga0466725_088577 | 3300042654 | Bacteria | 68253 |
| 48 | Ga0160469_100167 | 3300012824 | Bacteria | 67320 |
| 49 | Ga0160458_100481 | 3300012832 | Unclassified | 16752 |
| 50 | Ga0160444_100184 | 3300012841 | Bacteria | 57666 |
| 51 | Ga0160448_102667 | 3300012854 | Bacteria | 5411 |
| 52 | Ga0255572_1000001 | 3300026175 | Bacteria | 634207 |
| 53 | Ga0466715_055075 | 3300042616 | Bacteria | 9499 |
| 54 | Ga0466701_084396 | 3300042598 | Bacteria | 1328 |
| 55 | CVPL005W_1000006 | 3300002934 | Bacteria | 74018 |
| 56 | CVPL005L_10000356 | 3300002938 | Bacteria | 44629 |
| 57 | Ga0102739_1000653 | 3300007095 | Unclassified | 6652 |
| 58 | Ga0103264_1000084 | 3300007188 | Bacteria | 85371 |
| 59 | Ga0103268_1000007 | 3300007192 | Bacteria | 70891 |
| 60 | Ga0105005_1283916 | 3300007505 | Bacteria | 1718 |
| 61 | Ga0466730_028493 | 3300042625 | Bacteria | 15716 |
| 62 | Ga0466704_079146 | 3300042643 | Unclassified | 8344 |
| 63 | Ga0466724_39594 | 3300042649 | Bacteria | 173367 |
| 64 | Ga0160453_100671 | 3300012814 | Bacteria | 21144 |
| 65 | Ga0160456_100037 | 3300012820 | Bacteria | 206901 |
| 66 | Ga0160459_100216 | 3300012831 | Bacteria | 30400 |
| 67 | Ga0160433_100031 | 3300012846 | Bacteria | 172603 |
| 68 | Ga0466696_365474 | 3300042596 | Bacteria | 3098 |
| 69 | Ga0160466_100906 | 3300012809 | Bacteria | 10656 |
| 70 | CVPL010W_10001627 | 3300002931 | Bacteria | 26446 |
| 71 | CVPL010W_10005337 | 3300002931 | Bacteria | 13789 |
| 72 | Ga0103260_1001545 | 3300007139 | Bacteria | 4085 |
| 73 | Ga0103260_1007583 | 3300007139 | Unclassified | 1533 |
| 74 | Ga0102740_1003560 | 3300007140 | Unclassified | 3299 |
| 75 | Ga0102737_1018442 | 3300007142 | Bacteria | 1097 |
| 76 | Ga0104050_1204441 | 3300007153 | Bacteria | 1358 |
| 77 | Ga0103264_1002696 | 3300007188 | Bacteria | 9734 |
| 78 | Ga0103268_1004407 | 3300007192 | Bacteria | 2862 |
| 79 | Ga0466709_127110 | 3300042648 | Bacteria | 13816 |
| 80 | Ga0466724_26957 | 3300042649 | Bacteria | 4562 |
| 81 | Ga0160453_100351 | 3300012814 | Bacteria | 39462 |
| 82 | Ga0160456_100068 | 3300012820 | Bacteria | 152443 |
| 83 | Ga0160469_100700 | 3300012824 | Bacteria | 12761 |
| 84 | Ga0160457_1000108 | 3300012858 | Bacteria | 107648 |
| 85 | Ga0160470_100097 | 3300012813 | Bacteria | 104057 |
| 86 | Ga0466701_022881 | 3300042598 | Bacteria | 168971 |
| 87 | Ga0466719_226132 | 3300042606 | Bacteria | 7903 |
| 88 | DPOL_contig20320 | 2035918003 | Bacteria | 28824 |
| 89 | SPBB_contig00119 | 2044078006 | Bacteria | 65477 |
| 90 | FGTW_contig31062 | 2065487013 | Bacteria | 6462 |
| 91 | Meta3P_1000076 | 3300002464 | Unclassified | 9106 |
| 92 | CVPL005L_10000630 | 3300002938 | Bacteria | 57206 |
| 93 | Ga0103265_1000504 | 3300007068 | Bacteria | 6617 |
| 94 | Ga0103261_1004778 | 3300007083 | Unclassified | 2023 |
| 95 | Ga0104045_1002797 | 3300007085 | Unclassified | 3575 |
| 96 | Ga0102739_1001086 | 3300007095 | Bacteria | 4655 |
| 97 | Ga0102739_1002899 | 3300007095 | Bacteria | 2575 |
| 98 | Ga0102738_1000013 | 3300007141 | Bacteria | 98326 |
| 99 | Ga0103267_1000338 | 3300007190 | Bacteria | 39378 |
| 100 | Ga0103268_1001701 | 3300007192 | Bacteria | 5247 |
| 101 | Ga0466730_007515 | 3300042625 | Bacteria | 5913 |
| 102 | Ga0466724_48131 | 3300042649 | Bacteria | 30866 |
| 103 | Ga0466724_49806 | 3300042649 | Bacteria | 82893 |
| 104 | Ga0160434_117414 | 3300012850 | Bacteria | 1120 |
| 105 | Ga0466701_075385 | 3300042598 | Bacteria | 3263 |
| 106 | DPOL_contig01279 | 2035918003 | Bacteria | 10695 |
| 107 | CVPL010W_10000023 | 3300002931 | Bacteria | 82344 |
| 108 | Ga0103265_1001877 | 3300007068 | Unclassified | 3316 |
| 109 | Ga0102740_1001682 | 3300007140 | Bacteria | 5433 |
| 110 | Ga0102738_1009336 | 3300007141 | Bacteria | 1346 |
| 111 | Ga0103264_1000011 | 3300007188 | Bacteria | 185120 |
| 112 | Ga0103267_1000150 | 3300007190 | Bacteria | 27389 |
| 113 | Ga0160436_1003724 | 3300012861 | Bacteria | 3717 |
| 114 | Ga0466705_030393 | 3300042612 | Bacteria | 5130 |
| 115 | CVPL005L_10020713 | 3300002938 | Bacteria | 3309 |
| 116 | Ga0102737_1006802 | 3300007142 | Unclassified | 2138 |
| 117 | Ga0103264_1000195 | 3300007188 | Bacteria | 65205 |
| 118 | Ga0103264_1000234 | 3300007188 | Bacteria | 31647 |
| 119 | Ga0466724_12714 | 3300042649 | Unclassified | 4561 |
| 120 | Ga0466724_48190 | 3300042649 | Bacteria | 3443 |
| 121 | Ga0160441_102953 | 3300012825 | Bacteria | 3105 |
| 122 | Ga0160460_100630 | 3300012845 | Bacteria | 17771 |
| 123 | Ga0160447_101655 | 3300012849 | Bacteria | 8459 |
| 124 | Ga0160430_109634 | 3300012852 | Bacteria | 1720 |
| 125 | Ga0309902_000002 | 3300028910 | Bacteria | 357102 |
| 126 | Ga0466690_043013 | 3300042590 | Bacteria | 5735 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02673 | BacA | Bacitracin resistance protein BacA | 39 | 289 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.