Protein Family IF03516
Metagenome
Isolate
208
Members
81
Samples
159
Scaffolds
207.65
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10150065|Ga0123354_101500655
- Length
- 234 aa
- Sequence
- VCNHRKDIKIIFINQFKNKVVMARKLPVYLVLDTSGSMMGEPIAAVETGVQTLVSALRQDPYALETAYLSVITFDSSAKQLVPLTELTAFQPPSIQASGTTALGEALSLLAKKIDAEVTKTTSEVKGDWKPLVFIMTDGGPTDNWQSGLAEFRKRKTGMVIACAAGQGADLNVLKQITECVVQLDTADSSTIKAFFKWVSASVSTGSQKVDSGNEMVGLGELPPXXXEVNIVV*
Sample Types
Isolate
17.8%
Metagenome
82.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
23.4%
Kalotermitidae
18.2%
Unclassified
13.0%
Coreidae
7.8%
Apidae
6.5%
Curculionidae
5.2%
Rhinotermitidae
5.2%
Termopsidae
5.2%
Passalidae
2.6%
Culicidae
2.6%
Formicidae
2.6%
Hydrophilidae
2.6%
Blattidae
1.3%
Cerambycidae
1.3%
Tenebrionidae
1.3%
Ceratophyllidae
1.3%
Taxonomy
Archaea
0
Bacteria
191
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 3 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 4 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 5 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 6 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 7 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 8 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 25 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 26 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 27 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 28 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 35 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 36 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 37 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 38 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 41 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 42 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 51 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 52 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 53 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 56 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 57 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 58 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 59 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 60 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 61 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 62 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 63 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 64 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 65 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 66 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 67 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 68 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 69 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 70 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 71 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 72 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 73 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 74 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 75 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 76 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 77 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 78 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 79 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 80 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 81 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | gam1t_NODE_328496_length=20177_GC=32_9_Contigs=4 | 2189573031 | Bacteria | 20207 |
| 2 | JGI24698J34947_10108168 | 3300002449 | Bacteria | 1233 |
| 3 | Ga0102735_1000212 | 3300007080 | Bacteria | 15005 |
| 4 | Ga0466705_267018 | 3300042612 | Bacteria | 2077 |
| 5 | Ga0123353_10029456 | 3300010167 | Bacteria | 8461 |
| 6 | Ga0265387_1007895 | 3300024582 | Bacteria | 1428 |
| 7 | Ga0466691_166176 | 3300042593 | Unclassified | 3816 |
| 8 | Ga0466723_115152 | 3300042618 | Unclassified | 9405 |
| 9 | Ga0466703_093762 | 3300042636 | Bacteria | 11192 |
| 10 | Ga0466703_327247 | 3300042636 | Bacteria | 27627 |
| 11 | Ga0466725_114107 | 3300042654 | Bacteria | 39880 |
| 12 | Ga0466727_172825 | 3300042655 | Unclassified | 7554 |
| 13 | Ga0466716_079548 | 3300042605 | Bacteria | 1036 |
| 14 | Ga0466719_114801 | 3300042606 | Bacteria | 2448 |
| 15 | Ga0466722_083330 | 3300042609 | Bacteria | 2368 |
| 16 | Ga0466722_111476 | 3300042609 | Bacteria | 56871 |
| 17 | Ga0466698_342721 | 3300042610 | Bacteria | 1968 |
| 18 | 2227488524 | 2225789004 | Bacteria | 20954 |
| 19 | SCG598I22_11348 | 3300000462 | Unclassified | 56222 |
| 20 | Ga0466705_025667 | 3300042612 | Bacteria | 7922 |
| 21 | Ga0466705_066055 | 3300042612 | Bacteria | 1129 |
| 22 | Ga0466690_359734 | 3300042590 | Bacteria | 1900 |
| 23 | Ga0466692_047101 | 3300042591 | Bacteria | 2685 |
| 24 | Ga0466693_216543 | 3300042592 | Bacteria | 6240 |
| 25 | Ga0466691_068333 | 3300042593 | Bacteria | 5614 |
| 26 | Ga0466696_241125 | 3300042596 | Bacteria | 14650 |
| 27 | Ga0466703_053004 | 3300042636 | Bacteria | 8941 |
| 28 | Ga0466704_523685 | 3300042643 | Unclassified | 4455 |
| 29 | Ga0466704_567469 | 3300042643 | Bacteria | 18060 |
| 30 | Ga0466709_031136 | 3300042648 | Bacteria | 13543 |
| 31 | Ga0466708_085582 | 3300042652 | Bacteria | 26065 |
| 32 | Ga0466700_451162 | 3300042600 | Bacteria | 1710 |
| 33 | Ga0466713_030772 | 3300042602 | Bacteria | 37715 |
| 34 | Ga0466719_177981 | 3300042606 | Bacteria | 1223 |
| 35 | Ga0063521_1047054 | 3300003973 | Bacteria | 938 |
| 36 | Ga0072941_1003524 | 3300005201 | Bacteria | 1667 |
| 37 | Ga0466705_255339 | 3300042612 | Unclassified | 1953 |
| 38 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 39 | Ga0160452_100219 | 3300012834 | Bacteria | 59804 |
| 40 | Ga0466692_130465 | 3300042591 | Bacteria | 2975 |
| 41 | Ga0466691_017847 | 3300042593 | Bacteria | 44068 |
| 42 | Ga0466696_352895 | 3300042596 | Bacteria | 1687 |
| 43 | Ga0466696_363236 | 3300042596 | Bacteria | 1251 |
| 44 | Ga0466711_146986 | 3300042615 | Bacteria | 3449 |
| 45 | Ga0466715_015949 | 3300042616 | Bacteria | 7310 |
| 46 | Ga0466723_361650 | 3300042618 | Bacteria | 13087 |
| 47 | Ga0466726_110470 | 3300042619 | Bacteria | 3513 |
| 48 | Ga0466726_403968 | 3300042619 | Bacteria | 4744 |
| 49 | Ga0466728_282227 | 3300042620 | Bacteria | 28133 |
| 50 | Ga0466708_193749 | 3300042652 | Bacteria | 3318 |
| 51 | Ga0466701_092879 | 3300042598 | Bacteria | 8782 |
| 52 | Ga0466707_185685 | 3300042601 | Bacteria | 20469 |
| 53 | Ga0466716_134867 | 3300042605 | Bacteria | 3527 |
| 54 | Ga0466719_084517 | 3300042606 | Bacteria | 1396 |
| 55 | Ga0466719_219709 | 3300042606 | Bacteria | 16892 |
| 56 | Ga0466719_252720 | 3300042606 | Bacteria | 1031 |
| 57 | JGI24705J35276_11930322 | 3300002504 | Bacteria | 776 |
| 58 | Ga0123353_10050580 | 3300010167 | Bacteria | 6626 |
| 59 | Ga0123353_10647953 | 3300010167 | Bacteria | 1496 |
| 60 | Ga0123354_10150065 | 3300010882 | Bacteria | 2829 |
| 61 | Ga0123354_10252681 | 3300010882 | Bacteria | 1781 |
| 62 | Ga0415639_240727 | 3300038395 | Bacteria | 1380 |
| 63 | Ga0466690_157732 | 3300042590 | Bacteria | 7711 |
| 64 | Ga0466690_359889 | 3300042590 | Bacteria | 16085 |
| 65 | Ga0466692_173446 | 3300042591 | Bacteria | 3630 |
| 66 | Ga0466696_121934 | 3300042596 | Bacteria | 12773 |
| 67 | Ga0466696_181247 | 3300042596 | Bacteria | 2432 |
| 68 | Ga0466696_371169 | 3300042596 | Bacteria | 1198 |
| 69 | Ga0466696_440328 | 3300042596 | Bacteria | 13966 |
| 70 | Ga0466723_252759 | 3300042618 | Bacteria | 2545 |
| 71 | Ga0466726_119999 | 3300042619 | Bacteria | 1301 |
| 72 | Ga0466728_227686 | 3300042620 | Bacteria | 1740 |
| 73 | Ga0466728_442736 | 3300042620 | Bacteria | 1598 |
| 74 | Ga0466735_061818 | 3300042624 | Bacteria | 1896 |
| 75 | Ga0466704_469331 | 3300042643 | Bacteria | 1400 |
| 76 | Ga0466708_322972 | 3300042652 | Bacteria | 10051 |
| 77 | Ga0466727_124598 | 3300042655 | Bacteria | 5005 |
| 78 | Ga0466716_078868 | 3300042605 | Bacteria | 1333 |
| 79 | Ga0466716_130689 | 3300042605 | Bacteria | 4078 |
| 80 | Ga0466698_166538 | 3300042610 | Bacteria | 1619 |
| 81 | JGI24702J35022_10005921 | 3300002462 | Bacteria | 7104 |
| 82 | Ga0068302_10226715 | 3300005071 | Unclassified | 2152 |
| 83 | Ga0466705_172980 | 3300042612 | Bacteria | 40831 |
| 84 | Ga0466733_033287 | 3300042659 | Bacteria | 8977 |
| 85 | Ga0466696_024151 | 3300042596 | Bacteria | 5642 |
| 86 | Ga0466705_517287 | 3300042612 | Bacteria | 3543 |
| 87 | Ga0466711_269463 | 3300042615 | Bacteria | 35185 |
| 88 | Ga0466711_406034 | 3300042615 | Bacteria | 13555 |
| 89 | Ga0466723_127926 | 3300042618 | Bacteria | 5961 |
| 90 | Ga0466726_135252 | 3300042619 | Bacteria | 11272 |
| 91 | Ga0466729_070847 | 3300042621 | Bacteria | 3045 |
| 92 | Ga0466703_065898 | 3300042636 | Unclassified | 7807 |
| 93 | Ga0466708_129698 | 3300042652 | Bacteria | 22151 |
| 94 | Ga0466714_054700 | 3300042603 | Bacteria | 7581 |
| 95 | Ga0466722_103565 | 3300042609 | Bacteria | 17455 |
| 96 | Ga0466722_227673 | 3300042609 | Bacteria | 3490 |
| 97 | IMNBL1DRAFT_c0000546 | 3300000062 | Bacteria | 30663 |
| 98 | JGI24702J35022_10000159 | 3300002462 | Bacteria | 35048 |
| 99 | Ga0103263_100255 | 3300007042 | Bacteria | 7737 |
| 100 | Ga0123356_10504107 | 3300010049 | Bacteria | 1367 |
| 101 | Ga0466656_190801 | 3300042550 | Bacteria | 2231 |
| 102 | Ga0466690_350264 | 3300042590 | Bacteria | 11301 |
| 103 | Ga0466692_043899 | 3300042591 | Bacteria | 67267 |
| 104 | Ga0466693_068384 | 3300042592 | Unclassified | 3216 |
| 105 | Ga0466705_410446 | 3300042612 | Bacteria | 3579 |
| 106 | Ga0466711_199870 | 3300042615 | Bacteria | 28300 |
| 107 | Ga0466715_031419 | 3300042616 | Bacteria | 10947 |
| 108 | Ga0466715_557312 | 3300042616 | Bacteria | 2004 |
| 109 | Ga0466723_106278 | 3300042618 | Bacteria | 2638 |
| 110 | Ga0466728_191431 | 3300042620 | Unclassified | 5314 |
| 111 | Ga0466709_063590 | 3300042648 | Bacteria | 58332 |
| 112 | Ga0466708_125079 | 3300042652 | Bacteria | 2633 |
| 113 | Ga0466727_306226 | 3300042655 | Bacteria | 7497 |
| 114 | Ga0466713_092176 | 3300042602 | Bacteria | 1266 |
| 115 | Ga0466719_166455 | 3300042606 | Bacteria | 2101 |
| 116 | Ga0466719_400543 | 3300042606 | Bacteria | 5476 |
| 117 | Ga0466719_419689 | 3300042606 | Bacteria | 6279 |
| 118 | Ga0466722_015822 | 3300042609 | Bacteria | 18783 |
| 119 | Ga0466722_182659 | 3300042609 | Bacteria | 26051 |
| 120 | gam1t_NODE_248298_length=35038_GC=33_7_Contigs=2 | 2189573031 | Bacteria | 35048 |
| 121 | Ga0466693_245282 | 3300042592 | Bacteria | 1539 |
| 122 | Ga0466711_081776 | 3300042615 | Bacteria | 5792 |
| 123 | Ga0466711_260102 | 3300042615 | Bacteria | 9495 |
| 124 | Ga0466715_133283 | 3300042616 | Unclassified | 6070 |
| 125 | Ga0466723_119704 | 3300042618 | Unclassified | 3798 |
| 126 | Ga0466726_424796 | 3300042619 | Bacteria | 2157 |
| 127 | Ga0466703_351823 | 3300042636 | Bacteria | 9738 |
| 128 | Ga0466708_045140 | 3300042652 | Bacteria | 8754 |
| 129 | Ga0466725_174045 | 3300042654 | Bacteria | 27264 |
| 130 | Ga0466727_009467 | 3300042655 | Bacteria | 6884 |
| 131 | Ga0466713_134526 | 3300042602 | Bacteria | 4914 |
| 132 | Ga0466716_011834 | 3300042605 | Bacteria | 1394 |
| 133 | Ga0466698_294476 | 3300042610 | Bacteria | 2136 |
| 134 | JGI24699J35502_11129406 | 3300002509 | Bacteria | 4700 |
| 135 | JGI24699J35502_11132846 | 3300002509 | Bacteria | 7764 |
| 136 | JGI24696J40584_12951784 | 3300002834 | Bacteria | 2277 |
| 137 | Ga0466705_063283 | 3300042612 | Bacteria | 2379 |
| 138 | Ga0466732_146434 | 3300042656 | Bacteria | 41117 |
| 139 | Ga0123353_10504316 | 3300010167 | Bacteria | 1762 |
| 140 | Ga0123354_10004791 | 3300010882 | Bacteria | 19341 |
| 141 | Ga0466690_022101 | 3300042590 | Unclassified | 12839 |
| 142 | Ga0466690_339476 | 3300042590 | Bacteria | 22176 |
| 143 | Ga0466691_047475 | 3300042593 | Bacteria | 16186 |
| 144 | Ga0466691_124429 | 3300042593 | Bacteria | 12355 |
| 145 | Ga0466691_228609 | 3300042593 | Bacteria | 15455 |
| 146 | Ga0466723_049715 | 3300042618 | Bacteria | 5387 |
| 147 | Ga0466728_197250 | 3300042620 | Bacteria | 4511 |
| 148 | Ga0466703_044201 | 3300042636 | Bacteria | 1726 |
| 149 | Ga0466703_052722 | 3300042636 | Unclassified | 2709 |
| 150 | Ga0466703_129232 | 3300042636 | Bacteria | 3357 |
| 151 | Ga0466703_307474 | 3300042636 | Bacteria | 9453 |
| 152 | Ga0466704_261484 | 3300042643 | Unclassified | 4443 |
| 153 | Ga0466709_195820 | 3300042648 | Bacteria | 1937 |
| 154 | Ga0466709_319293 | 3300042648 | Bacteria | 8514 |
| 155 | Ga0466707_106928 | 3300042601 | Bacteria | 18647 |
| 156 | Ga0466713_077082 | 3300042602 | Unclassified | 1210 |
| 157 | Ga0466719_148403 | 3300042606 | Bacteria | 9045 |
| 158 | Ga0466722_172558 | 3300042609 | Bacteria | 14918 |
| 159 | Ga0466722_241799 | 3300042609 | Bacteria | 9410 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.