Protein Family IF03506

Metagenome Isolate
230 Members
141 Samples
158 Scaffolds
253.06 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10102567|Ga0123354_101025675
Length
292 aa
Sequence
MSADQPTAPEAAMVTIENLHKSFDNLEVLKGVSLQVGQGDVLCIIGPSGSGKSTLLRCLNQLETPTSGDVWVNGTKLTDPDVDIDAVRAHMGMVFQSFNLFPHLNARQNCMLGQTSVLKRSPADAKQIAEANLVKVGLFDRMDYFPGQLSGGQQQRVAIARALSMDPLLMLFDEPTSALDPELVGDVLSVMRQLADDGMTMIVVTHEMAFARDVADRVIFMDDGLIVEEGPPSQVISAPHEERTQVFLQRVLDPTHVREIGELEPDGVVPSWMSGRSGAPASPGLSDRPRP*

📊 Sample Types

Isolate 31.3%
Metagenome 68.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 19.7%
Termitidae 15.9%
Kalotermitidae 9.1%
Formicidae 7.6%
Apidae 5.3%
Blattidae 5.3%
Pyralidae 4.5%
Curculionidae 3.8%
Tenebrionidae 3.0%
Scarabaeidae 3.0%
Drosophilidae 3.0%
Rhinotermitidae 2.3%
Elmidae 1.5%
Bombycidae 1.5%
Passalidae 1.5%
Noctuidae 1.5%
Pentatomidae 1.5%
Culicidae 1.5%
Hodotermitidae 0.8%
Ocypodidae 0.8%
Cerambycidae 0.8%
Eresidae 0.8%
Coreidae 0.8%
Pyrrhocoridae 0.8%
Siricidae 0.8%
Portunidae 0.8%
Termopsidae 0.8%
Armadillidiidae 0.8%
Anthocoridae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 212
Eukaryota 0
Viruses 0
Unclassified 18

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
2 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
3 2684622921 Frischella perrara Fp_167 Isolate Unclassified
4 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
7 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
8 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
11 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
16 2833532623 Frischella perrara ESL0167 Isolate Apidae
17 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
18 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
19 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
23 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
28 8012112996 Staphylococcus muscae ATCC 49910 Isolate
29 8102982778 Erwinia sp. S63 Isolate Curculionidae
30 2978778678 Bacillus cereus 25 Isolate Ocypodidae
31 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
32 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
33 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
34 2864937364 Acidovorax soli S00198 Isolate Elmidae
35 2878462549 Gilliamella apicola Occ3-1 Isolate Apidae
36 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
37 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
38 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
39 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
40 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
43 2590828840 Clostridium sp. 2 Isolate Termitidae
44 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
45 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
46 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
47 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
48 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
49 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
50 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
51 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
52 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
53 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
54 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
55 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
56 8099192374 Erwinia typographi IC4 Isolate Curculionidae
57 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
58 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
59 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
60 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
61 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
62 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
63 2820893114 Unclassified Actinobacteria Lab288P1bin125 Isolate Unclassified
64 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
65 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
66 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
67 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
68 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
69 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
70 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
71 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
72 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
73 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
74 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
75 8022725327 Bacillus sp. SN10 Isolate Eresidae
76 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
77 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
78 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
79 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
80 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
81 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
82 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
83 2840797934 Gilliamella apicola Choc5-1 Isolate Apidae
84 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
85 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
86 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
87 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
88 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
89 8112490586 Staphylococcus muscae CCM 4175 Isolate
90 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
91 2537562000 Bacillus cereus HD73 Isolate Pyralidae
92 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
93 2603880170 Burkholderiales A2 Isolate Unclassified
94 2756170266 Frischella perrara DSM 104328 Isolate Unclassified
95 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
96 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
97 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
98 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
99 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
100 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
101 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
102 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
103 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
104 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
105 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
106 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
107 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
108 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
109 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
110 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
111 2515154034 Frischella perrara PEB0191 Isolate Apidae
112 2630968947 Frischella perrara PEB0191 Isolate Apidae
113 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
114 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
115 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
116 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
117 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
118 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
119 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
120 2969145278 Bacillus cereus 29 Isolate Portunidae
121 3007994558 Escherichia alba B35 Isolate Tenebrionidae
122 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
123 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
124 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
125 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
126 2593339125 Clostridium sp. 5 Isolate Termitidae
127 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
128 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
129 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
130 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
131 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
132 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
133 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
134 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
135 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
136 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
137 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
138 2820939604 Unclassified Actinobacteria Emb289P1bin4 Isolate Unclassified
139 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
140 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
141 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466695_370359 3300042595 Bacteria 11680
2 FGTW_contig00223 2065487013 Unclassified 20213
3 2227591312 2225789004 Bacteria 12864
4 JGI24705J35276_12208130 3300002504 Bacteria 1764
5 Ga0063521_1000879 3300003973 Bacteria 10141
6 Ga0104049_1004399 3300007103 Bacteria 1081
7 Ga0102734_1008961 3300007129 Bacteria 2295
8 Ga0466733_201987 3300042659 Bacteria 2520
9 Ga0466701_041623 3300042598 Bacteria 24851
10 Ga0466707_051094 3300042601 Bacteria 2829
11 Ga0466707_188782 3300042601 Bacteria 19023
12 Ga0466707_232510 3300042601 Unclassified 4830
13 Ga0466714_038349 3300042603 Bacteria 6534
14 Ga0466714_052766 3300042603 Bacteria 1823
15 Ga0466720_040719 3300042607 Bacteria 10757
16 Ga0466697_150587 3300042611 Bacteria 3485
17 Ga0466705_115761 3300042612 Bacteria 15581
18 Ga0466711_121812 3300042615 Bacteria 1643
19 Ga0466715_399208 3300042616 Bacteria 2402
20 Ga0123355_10211273 3300009826 Bacteria 2812
21 Ga0123356_10224060 3300010049 Bacteria 1939
22 Ga0123353_10089522 3300010167 Bacteria 4956
23 Ga0123353_11192455 3300010167 Bacteria 1000
24 Ga0123354_10327821 3300010882 Bacteria 1401
25 Ga0160431_103417 3300012828 Bacteria 3277
26 Ga0160430_116707 3300012852 Bacteria 1082
27 Ga0466692_064291 3300042591 Bacteria 28606
28 IMNBL1DRAFT_c0036919 3300000062 Bacteria 1700
29 JGI24705J35276_12221753 3300002504 Bacteria 2365
30 Ga0072941_1082977 3300005201 Bacteria 16250
31 Ga0105005_1009394 3300007505 Unclassified 16054
32 Ga0466701_019529 3300042598 Bacteria 146632
33 Ga0466706_255419 3300042599 Bacteria 2921
34 Ga0466722_097367 3300042609 Bacteria 7864
35 Ga0466709_281782 3300042648 Unclassified 8722
36 Ga0466715_282557 3300042616 Bacteria 25426
37 Ga0123356_10062737 3300010049 Bacteria 3472
38 Ga0123354_10009018 3300010882 Bacteria 15233
39 Ga0160456_100117 3300012820 Bacteria 82446
40 gam1t_NODE_657739_length=28572_GC=34_2_Contigs=1 2189573031 Unclassified 28572
41 CVPL010W_10000679 3300002931 Bacteria 37404
42 CVPL005W_1000098 3300002934 Bacteria 34913
43 Ga0068305_10001080 3300005083 Unclassified 53401
44 Ga0102734_1000815 3300007129 Bacteria 17909
45 Ga0102737_1000034 3300007142 Bacteria 38785
46 Ga0103268_1003107 3300007192 Bacteria 3523
47 Ga0562377_0291 3300056842 Bacteria 105987
48 Ga0562374_0201 3300057007 Unclassified 129306
49 Ga0466707_052291 3300042601 Bacteria 40320
50 Ga0466707_215693 3300042601 Bacteria 5520
51 Ga0466713_020587 3300042602 Bacteria 9070
52 Ga0466713_151904 3300042602 Unclassified 26033
53 Ga0466698_391013 3300042610 Bacteria 4021
54 Ga0466697_144897 3300042611 Bacteria 1833
55 Ga0466708_395980 3300042652 Bacteria 4762
56 Ga0466715_217695 3300042616 Bacteria 32243
57 Ga0123357_10019309 3300009784 Bacteria 9081
58 Ga0123355_10113091 3300009826 Bacteria 4235
59 Ga0123353_10997080 3300010167 Bacteria 1126
60 Ga0123354_10102567 3300010882 Bacteria 3855
61 Ga0466690_094955 3300042590 Bacteria 2405
62 Ga0466692_130639 3300042591 Bacteria 1565
63 Ga0466694_045875 3300042594 Bacteria 5021
64 AglaG_contig00590 2084038013 Bacteria 30393
65 Ga0102736_1001371 3300007052 Bacteria 4858
66 Ga0103265_1003889 3300007068 Bacteria 2169
67 Ga0104041_1117456 3300007106 Bacteria 1197
68 Ga0562377_0124 3300056842 Bacteria 238729
69 Ga0466706_122046 3300042599 Bacteria 228896
70 Ga0466707_191208 3300042601 Bacteria 2356
71 Ga0466707_268979 3300042601 Bacteria 22067
72 Ga0466707_312361 3300042601 Bacteria 5920
73 Ga0466713_113515 3300042602 Bacteria 7477
74 Ga0466719_123098 3300042606 Bacteria 142874
75 Ga0466730_036680 3300042625 Unclassified 1348
76 Ga0466703_053078 3300042636 Bacteria 1046
77 Ga0466704_027966 3300042643 Bacteria 9993
78 Ga0466704_243996 3300042643 Bacteria 1937
79 Ga0466715_092655 3300042616 Bacteria 7831
80 Ga0123357_10266328 3300009784 Bacteria 1800
81 Ga0123356_10005648 3300010049 Bacteria 12709
82 Ga0264413_106800 3300024493 Bacteria 8688
83 CVPL010W_10003672 3300002931 Unclassified 17512
84 Ga0063521_1000041 3300003973 Bacteria 111439
85 Ga0104041_1000226 3300007106 Bacteria 4873
86 Ga0102737_1000401 3300007142 Unclassified 14620
87 Ga0123357_10001398 3300009784 Bacteria 25552
88 Ga0562379_0013 3300056790 Bacteria 1548004
89 Ga0562379_1315 3300056790 Bacteria 29549
90 Ga0562377_0281 3300056842 Bacteria 109788
91 Ga0466713_045251 3300042602 Bacteria 1567
92 Ga0466716_264385 3300042605 Bacteria 4624
93 Ga0466730_087517 3300042625 Bacteria 3381
94 Ga0466709_314127 3300042648 Bacteria 22341
95 Ga0466705_448079 3300042612 Bacteria 7723
96 Ga0466729_093415 3300042621 Bacteria 1968
97 Ga0123357_10179115 3300009784 Bacteria 2481
98 Ga0123357_10518389 3300009784 Bacteria 976
99 Ga0123355_10000027 3300009826 Bacteria 144961
100 Ga0123353_10598219 3300010167 Bacteria 1577
101 Ga0160446_100056 3300012835 Bacteria 117140
102 Ga0466692_198067 3300042591 Bacteria 1984
103 Ga0466691_098498 3300042593 Unclassified 1407
104 SWWA_contig31653__length_27474___numreads_1390 2100351016 Bacteria 27474
105 IMNBL1DRAFT_c0000883 3300000062 Bacteria 23389
106 Ga0063521_1000198 3300003973 Bacteria 43640
107 Ga0063521_1001566 3300003973 Unclassified 6078
108 Ga0068305_10001799 3300005083 Bacteria 51560
109 Ga0103261_1003891 3300007083 Unclassified 4170
110 Ga0104042_1130400 3300007130 Unclassified 993
111 Ga0103264_1000277 3300007188 Bacteria 39968
112 Ga0103264_1000454 3300007188 Bacteria 21532
113 Ga0123357_10002876 3300009784 Bacteria 19414
114 Ga0466713_024159 3300042602 Bacteria 12757
115 Ga0466714_124349 3300042603 Bacteria 7338
116 Ga0466724_35576 3300042649 Bacteria 195054
117 Ga0466715_060527 3300042616 Bacteria 60092
118 Ga0466715_483723 3300042616 Bacteria 20509
119 Ga0123356_10172922 3300010049 Bacteria 2173
120 Ga0123356_10499069 3300010049 Bacteria 1373
121 Ga0123354_10292800 3300010882 Unclassified 1556
122 Ga0466692_128374 3300042591 Bacteria 5282
123 2227520475 2225789004 Bacteria 3351
124 Ga0072941_1000238 3300005201 Bacteria 99795
125 Ga0104049_1134337 3300007103 Unclassified 1316
126 Ga0102740_1009717 3300007140 Bacteria 1544
127 Ga0103264_1000056 3300007188 Bacteria 65902
128 Ga0103264_1006678 3300007188 Bacteria 6795
129 Ga0123357_10001578 3300009784 Bacteria 24355
130 Ga0123357_10002831 3300009784 Bacteria 19575
131 Ga0466706_114758 3300042599 Bacteria 2808
132 Ga0466707_307703 3300042601 Unclassified 5191
133 Ga0466707_358935 3300042601 Bacteria 1812
134 Ga0466713_008877 3300042602 Bacteria 23396
135 Ga0466703_394453 3300042636 Bacteria 58488
136 Ga0466709_270450 3300042648 Bacteria 23228
137 Ga0466708_290418 3300042652 Bacteria 41998
138 Ga0466705_531714 3300042612 Bacteria 1076
139 Ga0466711_296921 3300042615 Bacteria 6131
140 Ga0466711_459916 3300042615 Bacteria 4877
141 Ga0466723_286481 3300042618 Bacteria 2525
142 Ga0466729_074553 3300042621 Bacteria 3711
143 Ga0123357_10109615 3300009784 Bacteria 3526
144 Ga0160453_106904 3300012814 Bacteria 1607
145 Ga0466701_005840 3300042598 Bacteria 1465
146 IMNBL1DRAFT_c0000019 3300000062 Bacteria 170255
147 CVPL010W_10001712 3300002931 Bacteria 26028
148 CVPL010W_10006038 3300002931 Bacteria 12634
149 Ga0074278_149775 3300005721 Bacteria 28572
150 Ga0466734_165861 3300042623 Bacteria 18285
151 Ga0466735_059270 3300042624 Bacteria 1451
152 Ga0466724_34393 3300042649 Bacteria 82826
153 Ga0466715_247848 3300042616 Bacteria 37102
154 Ga0123357_10062084 3300009784 Bacteria 5005
155 Ga0123357_10127685 3300009784 Bacteria 3179
156 Ga0123356_10170913 3300010049 Bacteria 2184
157 Ga0123356_10906796 3300010049 Bacteria 1053
158 Ga0123353_10001177 3300010167 Bacteria 31963

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 29 177 0.94
PF03215 Rad17 Rad17 P-loop domain 27 98 0.78

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.