Protein Family IF03425

Metagenome Metatranscriptome Isolate
188 Members
70 Samples
135 Scaffolds
107.56 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_12687098|Ga0123353_126870982
Length
110 aa
Sequence
MDLENQKRVKTAVENYGAENVVVIIGAAEGEAAGLAAETVTNGDPTFAGPLAGVPLGLRVYHCVEQQFKSQVDSKVYDEQIGMMEMVLNIDEIVSEMKSIRDKFCQYKD*

📊 Sample Types

Isolate 28.2%
Metagenome 66.5%
MAG 0.0%
Metatranscriptome 5.3%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.8%
Unclassified 33.8%
Blattidae 16.2%
Tenebrionidae 4.4%
Passalidae 2.9%
Scarabaeidae 1.5%
Kalotermitidae 1.5%
Hydrophilidae 1.5%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 183
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
2 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
3 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
4 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
5 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
6 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
7 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
8 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
9 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
10 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
11 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
12 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
13 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
14 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
18 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
19 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
20 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
21 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
22 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
23 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
24 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
25 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
26 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
27 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
30 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
31 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
32 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
33 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
34 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
35 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
36 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
37 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
40 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
41 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
42 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
45 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
46 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
47 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300021244 Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA Metatranscriptome Termitidae
50 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
51 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
52 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
53 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
54 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
55 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
56 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
57 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
58 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
59 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
60 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
61 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
62 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
63 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
64 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
65 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
66 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
67 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
68 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
69 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
70 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_141144 3300038395 Bacteria 1164
2 Ga0466656_125541 3300042550 Bacteria 1455
3 Ga0123355_10347977 3300009826 Bacteria 1967
4 Ga0123355_10572182 3300009826 Bacteria 1355
5 Ga0123355_10626930 3300009826 Bacteria 1265
6 Ga0123355_11020032 3300009826 Bacteria 875
7 Ga0123355_11086395 3300009826 Bacteria 835
8 Ga0123356_10002891 3300010049 Bacteria 18192
9 Ga0123356_10356350 3300010049 Bacteria 1588
10 Ga0123356_10989815 3300010049 Bacteria 1011
11 Ga0123356_12850009 3300010049 Bacteria 605
12 Ga0123353_10004211 3300010167 Bacteria 18469
13 Ga0123353_10761126 3300010167 Bacteria 1346
14 Ga0466733_136686 3300042659 Bacteria 1449
15 Ga0466707_409312 3300042601 Bacteria 4136
16 Ga0466693_222464 3300042592 Bacteria 1413
17 Ga0123355_10064712 3300009826 Bacteria 5892
18 Ga0123355_10425636 3300009826 Bacteria 1693
19 Ga0123356_10341201 3300010049 Unclassified 1618
20 Ga0123356_10367256 3300010049 Bacteria 1568
21 Ga0123356_11066490 3300010049 Bacteria 977
22 Ga0123356_12468124 3300010049 Bacteria 651
23 Ga0123353_10081832 3300010167 Bacteria 5193
24 Ga0123353_10085235 3300010167 Bacteria 5087
25 Ga0123353_10225083 3300010167 Bacteria 2930
26 Ga0123353_10853877 3300010167 Bacteria 1247
27 Ga0123353_11798769 3300010167 Bacteria 761
28 Ga0123353_12687098 3300010167 Bacteria 586
29 Ga0123354_10541823 3300010882 Bacteria 882
30 JGI24695J34938_10000462 3300002450 Bacteria 39529
31 JGI24695J34938_10031625 3300002450 Bacteria 2453
32 JGI24702J35022_10384045 3300002462 Bacteria 845
33 Ga0466724_35272 3300042649 Bacteria 1164
34 Ga0562378_0019 3300056814 Bacteria 857275
35 Ga0466713_108291 3300042602 Bacteria 2146
36 Ga0222431_1005321 3300021190 Bacteria 1671
37 Ga0223686_1005052 3300021244 Bacteria 666
38 Ga0255786_1005810 3300022815 Bacteria 3251
39 Ga0415639_036571 3300038395 Bacteria 1566
40 Ga0123355_10000008 3300009826 Bacteria 191875
41 Ga0123355_10003385 3300009826 Bacteria 22828
42 Ga0123355_10820137 3300009826 Bacteria 1032
43 Ga0123353_10715457 3300010167 Bacteria 1402
44 Ga0123353_11565414 3300010167 Bacteria 835
45 Ga0123354_10610569 3300010882 Bacteria 795
46 IMNBL1DRAFT_c0103322 3300000062 Bacteria 764
47 Ga0466714_108758 3300042603 Bacteria 16582
48 Ga0233288_1002036 3300022232 Bacteria 1863
49 Ga0415639_011622 3300038395 Bacteria 14726
50 Ga0466695_111450 3300042595 Bacteria 1114
51 Ga0123355_10005491 3300009826 Bacteria 18585
52 Ga0123355_10069419 3300009826 Bacteria 5664
53 Ga0123355_10306861 3300009826 Bacteria 2156
54 Ga0123355_10455414 3300009826 Bacteria 1609
55 Ga0123356_10273689 3300010049 Bacteria 1780
56 Ga0123356_10868052 3300010049 Bacteria 1074
57 Ga0123353_10311437 3300010167 Bacteria 2396
58 Ga0123353_10312955 3300010167 Bacteria 2388
59 Ga0123353_10354506 3300010167 Unclassified 2209
60 Ga0123353_11549800 3300010167 Bacteria 840
61 Ga0123353_11778883 3300010167 Bacteria 767
62 Ga0123353_11924593 3300010167 Bacteria 728
63 JGI24695J34938_10028219 3300002450 Bacteria 2640
64 JGI24695J34938_10032974 3300002450 Bacteria 2387
65 Ga0562378_0021 3300056814 Bacteria 800040
66 Ga0562376_0438 3300056857 Bacteria 78254
67 Ga0466693_154051 3300042592 Bacteria 3168
68 Ga0123355_10511569 3300009826 Bacteria 1475
69 Ga0123355_11429960 3300009826 Unclassified 681
70 Ga0123356_10841315 3300010049 Bacteria 1089
71 Ga0123356_11049172 3300010049 Bacteria 984
72 Ga0123356_12244038 3300010049 Bacteria 682
73 Ga0123353_12013915 3300010167 Bacteria 707
74 JGI24695J34938_10023836 3300002450 Bacteria 2945
75 JGI24695J34938_10032066 3300002450 Bacteria 2432
76 Ga0222431_1000856 3300021190 Bacteria 5160
77 Ga0233288_1005594 3300022232 Bacteria 3221
78 Ga0123355_10000911 3300009826 Bacteria 40921
79 Ga0123355_10083818 3300009826 Bacteria 5080
80 Ga0123355_10305725 3300009826 Bacteria 2162
81 Ga0123355_10686348 3300009826 Bacteria 1181
82 Ga0123355_11596119 3300009826 Bacteria 629
83 Ga0123356_10113418 3300010049 Bacteria 2622
84 Ga0123356_10138946 3300010049 Bacteria 2394
85 Ga0123356_10374392 3300010049 Bacteria 1555
86 Ga0123356_10443685 3300010049 Bacteria 1445
87 Ga0123356_10459269 3300010049 Bacteria 1423
88 Ga0123356_11316774 3300010049 Bacteria 885
89 Ga0123356_11421099 3300010049 Bacteria 854
90 Ga0123353_10214287 3300010167 Bacteria 3018
91 Ga0123353_10370169 3300010167 Bacteria 2149
92 Ga0123353_11434359 3300010167 Bacteria 885
93 Ga0123353_11501170 3300010167 Bacteria 858
94 Ga0123353_13045945 3300010167 Unclassified 541
95 JGI24703J35330_11748283 3300002501 Bacteria 13053
96 Ga0466725_154695 3300042654 Bacteria 19274
97 Ga0466697_130603 3300042611 Bacteria 1016
98 Ga0562374_0016 3300057007 Bacteria 1205025
99 Ga0466701_021108 3300042598 Bacteria 1607
100 Ga0223686_1004993 3300021244 Bacteria 1890
101 Ga0223686_1005050 3300021244 Bacteria 826
102 Ga0415639_075031 3300038395 Bacteria 1853
103 Ga0123355_10002664 3300009826 Bacteria 25343
104 Ga0123355_11642145 3300009826 Bacteria 616
105 Ga0123356_10001317 3300010049 Bacteria 27475
106 Ga0123356_10557534 3300010049 Bacteria 1307
107 Ga0123356_10718927 3300010049 Bacteria 1168
108 Ga0123356_10973311 3300010049 Bacteria 1019
109 Ga0123353_10206459 3300010167 Bacteria 3085
110 Ga0123353_10609552 3300010167 Bacteria 1558
111 Ga0123353_11756786 3300010167 Bacteria 773
112 2227317475 2225789004 Bacteria 1195
113 2227524619 2225789004 Bacteria 16986
114 JGI24695J34938_10001712 3300002450 Bacteria 18141
115 JGI24702J35022_10000086 3300002462 Bacteria 41636
116 Ga0466715_591419 3300042616 Bacteria 30861
117 Ga0466706_019772 3300042599 Bacteria 18347
118 Ga0466700_203351 3300042600 Bacteria 1528
119 Ga0466717_228397 3300042604 Bacteria 2833
120 Ga0466721_249681 3300042608 Bacteria 4517
121 Ga0233288_1005962 3300022232 Bacteria 1509
122 Ga0255786_1004998 3300022815 Bacteria 3604
123 Ga0415639_001757 3300038395 Bacteria 4679
124 Ga0466656_118321 3300042550 Bacteria 1306
125 Ga0466693_060342 3300042592 Bacteria 4194
126 Ga0466693_385916 3300042592 Bacteria 3016
127 Ga0466693_443050 3300042592 Bacteria 1229
128 Ga0123355_10001355 3300009826 Bacteria 34038
129 Ga0123355_10005865 3300009826 Bacteria 18076
130 Ga0123356_11369268 3300010049 Unclassified 869
131 Ga0123356_12475839 3300010049 Bacteria 650
132 Ga0123353_10300577 3300010167 Bacteria 2450
133 Ga0123353_11867902 3300010167 Bacteria 743
134 Ga0123353_12876209 3300010167 Bacteria 562
135 Ga0123354_10491546 3300010882 Bacteria 963

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04723 GRDA Glycine reductase complex selenoprotein A 1 101 1

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.