Protein Family IF03406
Metagenome
Isolate
139
Members
55
Samples
131
Scaffolds
120.74
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_11787558|Ga0123353_117875581
- Length
- 140 aa
- Sequence
- LTIIGVGFGLQGKGGNDVKENVVKDKSKAFAIRVVRLYRHLCEDKKEYVLSKQVLRCGTSIGANIHEAIYGQSDKDFASKMSIALKEASETEYWLELLAETDYITPEEYKSIATDCSEINRLLISIVKSAKENLLKNKE*
Sample Types
Isolate
5.8%
Metagenome
94.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.2%
Kalotermitidae
20.8%
Unclassified
15.1%
Passalidae
5.7%
Rhinotermitidae
3.8%
Hodotermitidae
1.9%
Cambaridae
1.9%
Elmidae
1.9%
Termopsidae
1.9%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820074476 | Unclassified Proteobacteria Nt197P3bin125 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 23 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 26 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 27 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 28 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 29 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 32 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 33 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 34 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 35 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 36 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 45 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 46 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 47 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 52 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 53 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 55 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_171018 | 3300042612 | Bacteria | 3437 |
| 2 | Ga0466726_200228 | 3300042619 | Bacteria | 6533 |
| 3 | Ga0466728_153693 | 3300042620 | Bacteria | 1256 |
| 4 | Ga0123356_10436435 | 3300010049 | Bacteria | 1455 |
| 5 | Ga0123356_13634602 | 3300010049 | Bacteria | 534 |
| 6 | Ga0123353_11104714 | 3300010167 | Bacteria | 1052 |
| 7 | Ga0123354_10201086 | 3300010882 | Bacteria | 2190 |
| 8 | Ga0415639_114632 | 3300038395 | Bacteria | 1410 |
| 9 | Ga0466656_373818 | 3300042550 | Bacteria | 1713 |
| 10 | Ga0466692_093334 | 3300042591 | Bacteria | 10250 |
| 11 | Ga0466694_322381 | 3300042594 | Bacteria | 3159 |
| 12 | Ga0466699_227657 | 3300042597 | Bacteria | 3047 |
| 13 | Ga0466704_299654 | 3300042643 | Bacteria | 1406 |
| 14 | Ga0466708_059557 | 3300042652 | Bacteria | 20164 |
| 15 | Ga0466706_162352 | 3300042599 | Unclassified | 1061 |
| 16 | Ga0466697_086429 | 3300042611 | Bacteria | 2386 |
| 17 | Ga0466728_421299 | 3300042620 | Bacteria | 1666 |
| 18 | Ga0123357_10957879 | 3300009784 | Bacteria | 541 |
| 19 | Ga0123353_11193831 | 3300010167 | Bacteria | 999 |
| 20 | Ga0123353_11213709 | 3300010167 | Bacteria | 988 |
| 21 | Ga0123353_11787558 | 3300010167 | Bacteria | 765 |
| 22 | Ga0123353_11844989 | 3300010167 | Bacteria | 749 |
| 23 | Ga0123353_12960432 | 3300010167 | Bacteria | 551 |
| 24 | Ga0123353_13046011 | 3300010167 | Bacteria | 541 |
| 25 | JGI24702J35022_10045448 | 3300002462 | Bacteria | 2340 |
| 26 | Ga0466691_069610 | 3300042593 | Unclassified | 3398 |
| 27 | Ga0466734_097031 | 3300042623 | Bacteria | 2826 |
| 28 | Ga0466703_326150 | 3300042636 | Bacteria | 3241 |
| 29 | Ga0466709_127456 | 3300042648 | Bacteria | 8214 |
| 30 | Ga0466700_247874 | 3300042600 | Bacteria | 1461 |
| 31 | Ga0466719_520593 | 3300042606 | Bacteria | 2028 |
| 32 | Ga0123356_10680216 | 3300010049 | Bacteria | 1197 |
| 33 | Ga0123356_12125131 | 3300010049 | Bacteria | 701 |
| 34 | Ga0123353_10084336 | 3300010167 | Bacteria | 5115 |
| 35 | Ga0123353_10758729 | 3300010167 | Bacteria | 1349 |
| 36 | Ga0123353_11016047 | 3300010167 | Bacteria | 1112 |
| 37 | JGI24702J35022_10009464 | 3300002462 | Bacteria | 5466 |
| 38 | JGI24696J40584_12924928 | 3300002834 | Bacteria | 1394 |
| 39 | Ga0466694_204020 | 3300042594 | Bacteria | 1395 |
| 40 | Ga0466703_225369 | 3300042636 | Bacteria | 2607 |
| 41 | Ga0466704_140169 | 3300042643 | Bacteria | 11571 |
| 42 | Ga0466700_149054 | 3300042600 | Bacteria | 2443 |
| 43 | Ga0466700_283863 | 3300042600 | Bacteria | 7681 |
| 44 | Ga0466714_157815 | 3300042603 | Bacteria | 1918 |
| 45 | Ga0466716_240958 | 3300042605 | Bacteria | 25077 |
| 46 | Ga0466715_419643 | 3300042616 | Bacteria | 3980 |
| 47 | Ga0466726_362856 | 3300042619 | Bacteria | 4703 |
| 48 | Ga0123356_10029231 | 3300010049 | Bacteria | 5163 |
| 49 | Ga0123356_10061856 | 3300010049 | Bacteria | 3496 |
| 50 | Ga0123354_10601750 | 3300010882 | Bacteria | 805 |
| 51 | Ga0466691_021549 | 3300042593 | Bacteria | 6637 |
| 52 | Ga0466695_103273 | 3300042595 | Bacteria | 1403 |
| 53 | Ga0466703_421117 | 3300042636 | Bacteria | 6721 |
| 54 | Ga0466704_511818 | 3300042643 | Bacteria | 5066 |
| 55 | Ga0466719_463841 | 3300042606 | Bacteria | 1096 |
| 56 | Ga0466733_113943 | 3300042659 | Bacteria | 1133 |
| 57 | Ga0466718_049030 | 3300042617 | Unclassified | 1589 |
| 58 | Ga0466726_457053 | 3300042619 | Bacteria | 4426 |
| 59 | Ga0123355_10302873 | 3300009826 | Bacteria | 2176 |
| 60 | Ga0123356_10455424 | 3300010049 | Bacteria | 1428 |
| 61 | Ga0123356_10736279 | 3300010049 | Bacteria | 1156 |
| 62 | Ga0123356_11274963 | 3300010049 | Bacteria | 899 |
| 63 | Ga0123353_10615736 | 3300010167 | Bacteria | 1547 |
| 64 | Ga0123353_11314446 | 3300010167 | Bacteria | 937 |
| 65 | Ga0123353_11842287 | 3300010167 | Bacteria | 750 |
| 66 | IMNBGM34_c001717 | 3300000036 | Bacteria | 3537 |
| 67 | JGI24696J40584_12674477 | 3300002834 | Bacteria | 713 |
| 68 | Ga0265387_1003202 | 3300024582 | Bacteria | 2276 |
| 69 | Ga0466709_281038 | 3300042648 | Bacteria | 1057 |
| 70 | Ga0466724_08811 | 3300042649 | Bacteria | 2515 |
| 71 | Ga0466706_066443 | 3300042599 | Bacteria | 2063 |
| 72 | Ga0466706_087697 | 3300042599 | Bacteria | 7622 |
| 73 | Ga0466706_089579 | 3300042599 | Bacteria | 4075 |
| 74 | Ga0466713_024937 | 3300042602 | Bacteria | 20187 |
| 75 | Ga0466722_065742 | 3300042609 | Bacteria | 8882 |
| 76 | Ga0466710_070129 | 3300042613 | Bacteria | 5781 |
| 77 | Ga0466715_471164 | 3300042616 | Bacteria | 10766 |
| 78 | Ga0123357_10362682 | 3300009784 | Bacteria | 1370 |
| 79 | Ga0123355_10067132 | 3300009826 | Bacteria | 5773 |
| 80 | Ga0123355_10557068 | 3300009826 | Bacteria | 1383 |
| 81 | Ga0123356_11621680 | 3300010049 | Bacteria | 801 |
| 82 | Ga0123353_10040317 | 3300010167 | Bacteria | 7366 |
| 83 | Ga0123353_10976500 | 3300010167 | Bacteria | 1142 |
| 84 | Ga0123353_11969082 | 3300010167 | Bacteria | 717 |
| 85 | Ga0123354_10279949 | 3300010882 | Bacteria | 1622 |
| 86 | 2227386963 | 2225789004 | Bacteria | 1091 |
| 87 | JGI24702J35022_10025150 | 3300002462 | Bacteria | 3215 |
| 88 | Ga0072940_1553254 | 3300005200 | Bacteria | 529 |
| 89 | Ga0466692_018806 | 3300042591 | Bacteria | 1826 |
| 90 | Ga0466699_289094 | 3300042597 | Bacteria | 1901 |
| 91 | Ga0466731_009040 | 3300042622 | Bacteria | 1001 |
| 92 | Ga0466704_019050 | 3300042643 | Bacteria | 3281 |
| 93 | Ga0466707_049169 | 3300042601 | Bacteria | 3694 |
| 94 | Ga0466705_012181 | 3300042612 | Bacteria | 1005 |
| 95 | Ga0466726_167529 | 3300042619 | Bacteria | 4499 |
| 96 | Ga0123356_10084528 | 3300010049 | Bacteria | 3008 |
| 97 | Ga0123356_10363962 | 3300010049 | Bacteria | 1574 |
| 98 | Ga0123356_10541469 | 3300010049 | Bacteria | 1324 |
| 99 | Ga0123356_11454425 | 3300010049 | Bacteria | 844 |
| 100 | Ga0123356_13606352 | 3300010049 | Bacteria | 536 |
| 101 | Ga0123353_13287145 | 3300010167 | Bacteria | 516 |
| 102 | IMNBL1DRAFT_c0145142 | 3300000062 | Bacteria | 611 |
| 103 | JGI24702J35022_10218580 | 3300002462 | Bacteria | 1097 |
| 104 | JGI24702J35022_10457170 | 3300002462 | Bacteria | 778 |
| 105 | JGI24696J40584_12877610 | 3300002834 | Bacteria | 1071 |
| 106 | Ga0072941_1012607 | 3300005201 | Bacteria | 25516 |
| 107 | Ga0466656_344177 | 3300042550 | Bacteria | 8780 |
| 108 | Ga0466692_097484 | 3300042591 | Bacteria | 11752 |
| 109 | Ga0466725_231984 | 3300042654 | Bacteria | 1224 |
| 110 | Ga0466706_071248 | 3300042599 | Unclassified | 3683 |
| 111 | Ga0466706_245069 | 3300042599 | Bacteria | 61147 |
| 112 | Ga0466707_143180 | 3300042601 | Bacteria | 1860 |
| 113 | Ga0466714_065282 | 3300042603 | Bacteria | 4966 |
| 114 | Ga0466716_065713 | 3300042605 | Bacteria | 1136 |
| 115 | Ga0466719_284132 | 3300042606 | Bacteria | 1986 |
| 116 | Ga0466719_291927 | 3300042606 | Bacteria | 5644 |
| 117 | Ga0466711_254713 | 3300042615 | Bacteria | 7567 |
| 118 | Ga0466718_035423 | 3300042617 | Bacteria | 1206 |
| 119 | Ga0466726_339130 | 3300042619 | Bacteria | 1051 |
| 120 | Ga0123357_10325881 | 3300009784 | Bacteria | 1509 |
| 121 | Ga0123356_10068959 | 3300010049 | Bacteria | 3315 |
| 122 | Ga0123353_10127694 | 3300010167 | Bacteria | 4083 |
| 123 | Ga0123353_10242124 | 3300010167 | Bacteria | 2802 |
| 124 | Ga0123353_10401626 | 3300010167 | Bacteria | 2039 |
| 125 | Ga0123353_12321933 | 3300010167 | Bacteria | 644 |
| 126 | Ga0123353_12891767 | 3300010167 | Bacteria | 560 |
| 127 | Ga0466699_310924 | 3300042597 | Bacteria | 13040 |
| 128 | Ga0466706_255212 | 3300042599 | Unclassified | 1643 |
| 129 | Ga0466717_309427 | 3300042604 | Bacteria | 12929 |
| 130 | Ga0466719_118770 | 3300042606 | Bacteria | 1519 |
| 131 | Ga0466720_216276 | 3300042607 | Bacteria | 2969 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042606 | Ga0466719_118770 | Ga0466719_118770_906_1220 | 104 |
| 2 | iso_pr_bacteria | 2921902974 | 2921905069 | 106 |
| 3 | 3300042609 | Ga0466722_065742 | Ga0466722_065742_5201_5542 | 113 |
| 4 | 2225789004 | 2227386963 | 2227832284 | 114 |
| 5 | 3300010049 | Ga0123356_10084528 | Ga0123356_100845282 | 114 |
| 6 | 3300010049 | Ga0123356_10363962 | Ga0123356_103639622 | 114 |
| 7 | 3300010049 | Ga0123356_11274963 | Ga0123356_112749632 | 114 |
| 8 | 3300042643 | Ga0466704_019050 | Ga0466704_019050_183_527 | 114 |
| 9 | 3300010049 | Ga0123356_10541469 | Ga0123356_105414692 | 115 |
| 10 | 3300010049 | Ga0123356_13634602 | Ga0123356_136346021 | 115 |
| 11 | 3300042599 | Ga0466706_255212 | Ga0466706_255212_1022_1369 | 115 |
| 12 | 3300042612 | Ga0466705_171018 | Ga0466705_171018_2457_2804 | 115 |
| 13 | 3300009784 | Ga0123357_10325881 | Ga0123357_103258813 | 116 |
| 14 | 3300010049 | Ga0123356_10068959 | Ga0123356_100689592 | 116 |
| 15 | 3300010049 | Ga0123356_13606352 | Ga0123356_136063521 | 116 |
| 16 | 3300010167 | Ga0123353_11844989 | Ga0123353_118449891 | 116 |
| 17 | 3300010167 | Ga0123353_12891767 | Ga0123353_128917671 | 116 |
| 18 | 3300010167 | Ga0123353_12960432 | Ga0123353_129604321 | 116 |
| 19 | 3300010167 | Ga0123353_13287145 | Ga0123353_132871451 | 116 |
| 20 | 3300042550 | Ga0466656_373818 | Ga0466656_373818_1238_1588 | 116 |
| 21 | 3300042599 | Ga0466706_245069 | Ga0466706_245069_49152_49502 | 116 |
| 22 | 3300042600 | Ga0466700_149054 | Ga0466700_149054_1593_1943 | 116 |
| 23 | 3300042611 | Ga0466697_086429 | Ga0466697_086429_310_660 | 116 |
| 24 | 3300042617 | Ga0466718_035423 | Ga0466718_035423_555_905 | 116 |
| 25 | 3300042617 | Ga0466718_049030 | Ga0466718_049030_31_381 | 116 |
| 26 | 3300000062 | IMNBL1DRAFT_c0145142 | IMNBL1DRAFT_01451421 | 117 |
| 27 | 3300009826 | Ga0123355_10557068 | Ga0123355_105570683 | 117 |
| 28 | 3300010049 | Ga0123356_10061856 | Ga0123356_100618562 | 117 |
| 29 | 3300010049 | Ga0123356_11454425 | Ga0123356_114544252 | 117 |
| 30 | 3300010167 | Ga0123353_10976500 | Ga0123353_109765001 | 117 |
| 31 | 3300010882 | Ga0123354_10601750 | Ga0123354_106017501 | 117 |
| 32 | 3300024582 | Ga0265387_1003202 | Ga0265387_10032023 | 117 |
| 33 | 3300042597 | Ga0466699_289094 | Ga0466699_289094_401_754 | 117 |
| 34 | 3300042597 | Ga0466699_310924 | Ga0466699_310924_11295_11648 | 117 |
| 35 | 3300042603 | Ga0466714_065282 | Ga0466714_065282_3489_3842 | 117 |
| 36 | 3300042613 | Ga0466710_070129 | Ga0466710_070129_1345_1698 | 117 |
| 37 | 3300042620 | Ga0466728_421299 | Ga0466728_421299_965_1318 | 117 |
| 38 | 3300042648 | Ga0466709_281038 | Ga0466709_281038_414_767 | 117 |
| 39 | 3300042652 | Ga0466708_059557 | Ga0466708_059557_7515_7868 | 117 |
| 40 | iso_pr_bacteria | 2508501067 | 2508837604 | 117 |
| 41 | iso_pr_bacteria | 2864882932 | 2864885913 | 117 |
| 42 | 3300002462 | JGI24702J35022_10218580 | JGI24702J35022_102185802 | 118 |
| 43 | 3300005200 | Ga0072940_1553254 | Ga0072940_15532541 | 118 |
| 44 | 3300009784 | Ga0123357_10957879 | Ga0123357_109578791 | 118 |
| 45 | 3300010049 | Ga0123356_10455424 | Ga0123356_104554242 | 118 |
| 46 | 3300010049 | Ga0123356_10736279 | Ga0123356_107362792 | 118 |
| 47 | 3300010049 | Ga0123356_11621680 | Ga0123356_116216802 | 118 |
| 48 | 3300010167 | Ga0123353_10401626 | Ga0123353_104016262 | 118 |
| 49 | 3300010167 | Ga0123353_11969082 | Ga0123353_119690822 | 118 |
| 50 | 3300042594 | Ga0466694_322381 | Ga0466694_322381_585_941 | 118 |
| 51 | 3300042603 | Ga0466714_157815 | Ga0466714_157815_900_1256 | 118 |
| 52 | 3300042659 | Ga0466733_113943 | Ga0466733_113943_134_490 | 118 |
| 53 | iso_pr_bacteria | 2820429680 | 2820430387 | 118 |
| 54 | iso_pr_bacteria | 2820736622 | 2820737882 | 118 |
| 55 | iso_pr_bacteria | 2820740053 | 2820740441 | 118 |
| 56 | 3300002462 | JGI24702J35022_10009464 | JGI24702J35022_100094642 | 119 |
| 57 | 3300002462 | JGI24702J35022_10025150 | JGI24702J35022_100251502 | 119 |
| 58 | 3300009826 | Ga0123355_10067132 | Ga0123355_100671322 | 119 |
| 59 | 3300010167 | Ga0123353_10242124 | Ga0123353_102421243 | 119 |
| 60 | 3300010882 | Ga0123354_10279949 | Ga0123354_102799492 | 119 |
| 61 | 3300038395 | Ga0415639_114632 | Ga0415639_114632_97_456 | 119 |
| 62 | 3300042595 | Ga0466695_103273 | Ga0466695_103273_28_387 | 119 |
| 63 | 3300042622 | Ga0466731_009040 | Ga0466731_009040_555_914 | 119 |
| 64 | 3300042636 | Ga0466703_326150 | Ga0466703_326150_418_777 | 119 |
| 65 | 3300042643 | Ga0466704_299654 | Ga0466704_299654_568_927 | 119 |
| 66 | 3300010049 | Ga0123356_10680216 | Ga0123356_106802162 | 120 |
| 67 | 3300010167 | Ga0123353_11193831 | Ga0123353_111938312 | 120 |
| 68 | 3300010167 | Ga0123353_11213709 | Ga0123353_112137092 | 120 |
| 69 | 3300010167 | Ga0123353_13046011 | Ga0123353_130460111 | 120 |
| 70 | 3300010882 | Ga0123354_10201086 | Ga0123354_102010862 | 120 |
| 71 | 3300042597 | Ga0466699_227657 | Ga0466699_227657_2616_2978 | 120 |
| 72 | 3300042599 | Ga0466706_066443 | Ga0466706_066443_994_1356 | 120 |
| 73 | 3300042600 | Ga0466700_247874 | Ga0466700_247874_455_817 | 120 |
| 74 | 3300042601 | Ga0466707_049169 | Ga0466707_049169_109_471 | 120 |
| 75 | 3300042620 | Ga0466728_153693 | Ga0466728_153693_393_755 | 120 |
| 76 | 3300042649 | Ga0466724_08811 | Ga0466724_08811_1849_2211 | 120 |
| 77 | 3300010167 | Ga0123353_10127694 | Ga0123353_101276943 | 121 |
| 78 | 3300010167 | Ga0123353_11314446 | Ga0123353_113144462 | 121 |
| 79 | 3300042601 | Ga0466707_143180 | Ga0466707_143180_415_780 | 121 |
| 80 | 3300042606 | Ga0466719_284132 | Ga0466719_284132_14_379 | 121 |
| 81 | 3300042619 | Ga0466726_339130 | Ga0466726_339130_481_846 | 121 |
| 82 | 3300042623 | Ga0466734_097031 | Ga0466734_097031_542_907 | 121 |
| 83 | 3300042636 | Ga0466703_225369 | Ga0466703_225369_1816_2181 | 121 |
| 84 | iso_pr_bacteria | 2820369699 | 2820371297 | 121 |
| 85 | 3300002834 | JGI24696J40584_12674477 | JGI24696J40584_126744772 | 122 |
| 86 | 3300005201 | Ga0072941_1012607 | Ga0072941_101260714 | 122 |
| 87 | 3300010049 | Ga0123356_10436435 | Ga0123356_104364353 | 122 |
| 88 | 3300010049 | Ga0123356_12125131 | Ga0123356_121251311 | 122 |
| 89 | 3300010167 | Ga0123353_10084336 | Ga0123353_100843362 | 122 |
| 90 | 3300010167 | Ga0123353_12321933 | Ga0123353_123219331 | 122 |
| 91 | 3300042591 | Ga0466692_093334 | Ga0466692_093334_1804_2172 | 122 |
| 92 | 3300042593 | Ga0466691_021549 | Ga0466691_021549_2608_2976 | 122 |
| 93 | 3300042593 | Ga0466691_069610 | Ga0466691_069610_2279_2647 | 122 |
| 94 | 3300042599 | Ga0466706_071248 | Ga0466706_071248_2104_2472 | 122 |
| 95 | 3300042605 | Ga0466716_240958 | Ga0466716_240958_4907_5275 | 122 |
| 96 | 3300042616 | Ga0466715_471164 | Ga0466715_471164_2081_2449 | 122 |
| 97 | 3300042619 | Ga0466726_200228 | Ga0466726_200228_5203_5571 | 122 |
| 98 | 3300042636 | Ga0466703_421117 | Ga0466703_421117_4027_4395 | 122 |
| 99 | 3300042643 | Ga0466704_140169 | Ga0466704_140169_5309_5677 | 122 |
| 100 | 3300042643 | Ga0466704_511818 | Ga0466704_511818_4489_4857 | 122 |
| 101 | 3300002834 | JGI24696J40584_12877610 | JGI24696J40584_128776101 | 123 |
| 102 | 3300002834 | JGI24696J40584_12924928 | JGI24696J40584_129249282 | 123 |
| 103 | 3300042606 | Ga0466719_463841 | Ga0466719_463841_329_700 | 123 |
| 104 | 3300042612 | Ga0466705_012181 | Ga0466705_012181_52_423 | 123 |
| 105 | 3300042616 | Ga0466715_419643 | Ga0466715_419643_3199_3570 | 123 |
| 106 | 3300042619 | Ga0466726_167529 | Ga0466726_167529_2063_2434 | 123 |
| 107 | 3300010167 | Ga0123353_10758729 | Ga0123353_107587292 | 124 |
| 108 | 3300010167 | Ga0123353_11104714 | Ga0123353_111047142 | 124 |
| 109 | 3300042550 | Ga0466656_344177 | Ga0466656_344177_671_1045 | 124 |
| 110 | 3300042599 | Ga0466706_162352 | Ga0466706_162352_292_666 | 124 |
| 111 | 3300042602 | Ga0466713_024937 | Ga0466713_024937_12169_12543 | 124 |
| 112 | 3300042606 | Ga0466719_291927 | Ga0466719_291927_1683_2057 | 124 |
| 113 | 3300000036 | IMNBGM34_c001717 | IMNBGM34_0017173 | 125 |
| 114 | 3300002462 | JGI24702J35022_10045448 | JGI24702J35022_100454483 | 125 |
| 115 | 3300010167 | Ga0123353_10615736 | Ga0123353_106157362 | 125 |
| 116 | 3300010167 | Ga0123353_11016047 | Ga0123353_110160472 | 125 |
| 117 | 3300042599 | Ga0466706_089579 | Ga0466706_089579_163_540 | 125 |
| 118 | 3300042607 | Ga0466720_216276 | Ga0466720_216276_1496_1873 | 125 |
| 119 | 3300042619 | Ga0466726_457053 | Ga0466726_457053_96_473 | 125 |
| 120 | iso_pr_bacteria | 2820074476 | 2820075418 | 125 |
| 121 | 3300002462 | JGI24702J35022_10457170 | JGI24702J35022_104571702 | 126 |
| 122 | 3300010167 | Ga0123353_10040317 | Ga0123353_100403172 | 126 |
| 123 | 3300042591 | Ga0466692_018806 | Ga0466692_018806_186_566 | 126 |
| 124 | 3300042591 | Ga0466692_097484 | Ga0466692_097484_10200_10580 | 126 |
| 125 | 3300042605 | Ga0466716_065713 | Ga0466716_065713_185_565 | 126 |
| 126 | 3300042648 | Ga0466709_127456 | Ga0466709_127456_6432_6815 | 127 |
| 127 | 3300010049 | Ga0123356_10029231 | Ga0123356_100292317 | 128 |
| 128 | 3300042606 | Ga0466719_520593 | Ga0466719_520593_1168_1554 | 128 |
| 129 | 3300042619 | Ga0466726_362856 | Ga0466726_362856_3516_3902 | 128 |
| 130 | 3300009826 | Ga0123355_10302873 | Ga0123355_103028732 | 129 |
| 131 | 3300042599 | Ga0466706_087697 | Ga0466706_087697_1905_2294 | 129 |
| 132 | 3300042600 | Ga0466700_283863 | Ga0466700_283863_1003_1395 | 130 |
| 133 | 3300042654 | Ga0466725_231984 | Ga0466725_231984_669_1064 | 131 |
| 134 | 3300042604 | Ga0466717_309427 | Ga0466717_309427_5509_6009 | 132 |
| 135 | 3300009784 | Ga0123357_10362682 | Ga0123357_103626822 | 135 |
| 136 | 3300042615 | Ga0466711_254713 | Ga0466711_254713_3128_3535 | 135 |
| 137 | 3300010167 | Ga0123353_11787558 | Ga0123353_117875581 | 140 |
| 138 | 3300010167 | Ga0123353_11842287 | Ga0123353_118422872 | 140 |
| 139 | 3300042594 | Ga0466694_204020 | Ga0466694_204020_578_1012 | 144 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05635 | 23S_rRNA_IVP | 23S rRNA-intervening sequence protein | 20 | 124 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.