Protein Family IF03336
Metagenome
Isolate
147
Members
84
Samples
114
Scaffolds
148.32
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10661154|Ga0123353_106611542
- Length
- 175 aa
- Sequence
- MISEKRRVWYHALKPNVSCHLEQERIVRAVIQRVSQARVEIEGKTLGSIGLGYLILLGVGHDDTEAEAAKLWAKIAKLRIFEDAQGKANLDLAQVGGQVLIISQFTLFANCKKGNRPSFTEAGSPEKANFLYEHFVSLARKDVAHVATGEFGAMMDVSLSNDGPFTIVLDTASL*
Sample Types
Isolate
22.4%
Metagenome
77.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
26.5%
Blattidae
21.7%
Unclassified
18.1%
Kalotermitidae
14.5%
Apidae
3.6%
Tenebrionidae
3.6%
Termopsidae
3.6%
Rhinotermitidae
2.4%
Passalidae
2.4%
Daphniidae
1.2%
Formicidae
1.2%
Hodotermitidae
1.2%
Taxonomy
Archaea
1
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 4 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2820023741 | Unclassified Spirochaetes Lab288P3bin165 | Isolate | Unclassified |
| 12 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 13 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 14 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 15 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 25 | 2820526825 | Unclassified Firmicutes Lab288P1bin16 | Isolate | Unclassified |
| 26 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 27 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 28 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 29 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 34 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 35 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 36 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 37 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 38 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 39 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 40 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 41 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 42 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 43 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 48 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 49 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 52 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 53 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 54 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 55 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 56 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 58 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 59 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 60 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 63 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 64 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 65 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 66 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 67 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 68 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 69 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 70 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 71 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 72 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 73 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 74 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 75 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 76 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 77 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 78 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 79 | 2820159668 | Unclassified Proteobacteria Cu122P3bin5 | Isolate | Unclassified |
| 80 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 81 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 82 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 83 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 84 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_126709 | 3300042659 | Bacteria | 25436 |
| 2 | Ga0562377_0049 | 3300056842 | Bacteria | 563353 |
| 3 | Ga0466710_403556 | 3300042613 | Unclassified | 1205 |
| 4 | Ga0466711_352782 | 3300042615 | Unclassified | 2165 |
| 5 | Ga0466707_052985 | 3300042601 | Bacteria | 6342 |
| 6 | Ga0466722_063028 | 3300042609 | Bacteria | 3360 |
| 7 | Ga0466697_006184 | 3300042611 | Bacteria | 2598 |
| 8 | Ga0466702_101397 | 3300042635 | Bacteria | 2113 |
| 9 | Ga0466704_173265 | 3300042643 | Bacteria | 5092 |
| 10 | Ga0466725_135922 | 3300042654 | Bacteria | 11501 |
| 11 | Ga0466725_253997 | 3300042654 | Bacteria | 5118 |
| 12 | Ga0123357_10065197 | 3300009784 | Bacteria | 4864 |
| 13 | Ga0123355_10247689 | 3300009826 | Bacteria | 2514 |
| 14 | Ga0123355_10369580 | 3300009826 | Bacteria | 1880 |
| 15 | Ga0123355_10962428 | 3300009826 | Bacteria | 914 |
| 16 | Ga0466656_208447 | 3300042550 | Bacteria | 1664 |
| 17 | Ga0530661_001134 | 3300056564 | Bacteria | 14914 |
| 18 | Ga0562374_0027 | 3300057007 | Bacteria | 841135 |
| 19 | Ga0466711_217973 | 3300042615 | Bacteria | 218633 |
| 20 | Ga0466713_127827 | 3300042602 | Bacteria | 94049 |
| 21 | Ga0466722_204264 | 3300042609 | Bacteria | 2504 |
| 22 | JGI24703J35330_11681828 | 3300002501 | Bacteria | 1817 |
| 23 | Ga0068305_10107413 | 3300005083 | Bacteria | 1612 |
| 24 | Ga0466702_390007 | 3300042635 | Bacteria | 1039 |
| 25 | Ga0466725_389043 | 3300042654 | Bacteria | 2740 |
| 26 | Ga0123353_10016295 | 3300010167 | Bacteria | 10857 |
| 27 | Ga0466690_189517 | 3300042590 | Bacteria | 7460 |
| 28 | Ga0466691_209283 | 3300042593 | Bacteria | 6901 |
| 29 | Ga0466705_315076 | 3300042612 | Bacteria | 18511 |
| 30 | Ga0466715_076767 | 3300042616 | Bacteria | 23423 |
| 31 | Ga0466723_281090 | 3300042618 | Bacteria | 178430 |
| 32 | Ga0466716_175246 | 3300042605 | Bacteria | 20455 |
| 33 | Ga0466722_034155 | 3300042609 | Bacteria | 1472 |
| 34 | IMNBL1DRAFT_c0057861 | 3300000062 | Archaea | 1180 |
| 35 | JGI24705J35276_12214997 | 3300002504 | Bacteria | 1984 |
| 36 | JGI24700J35501_10930342 | 3300002508 | Bacteria | 13148 |
| 37 | Ga0466734_077784 | 3300042623 | Bacteria | 1302 |
| 38 | Ga0466734_163208 | 3300042623 | Bacteria | 2941 |
| 39 | Ga0466734_170455 | 3300042623 | Bacteria | 1047 |
| 40 | Ga0466735_004361 | 3300042624 | Bacteria | 13569 |
| 41 | Ga0466704_180948 | 3300042643 | Bacteria | 1411 |
| 42 | Ga0466704_587507 | 3300042643 | Bacteria | 1020 |
| 43 | Ga0123356_10574319 | 3300010049 | Bacteria | 1290 |
| 44 | Ga0123353_11034373 | 3300010167 | Bacteria | 1099 |
| 45 | Ga0415639_144233 | 3300038395 | Bacteria | 9968 |
| 46 | Ga0466723_007065 | 3300042618 | Bacteria | 53793 |
| 47 | Ga0466706_151734 | 3300042599 | Bacteria | 6645 |
| 48 | Ga0466707_101624 | 3300042601 | Bacteria | 1954 |
| 49 | 2227471766 | 2225789004 | Bacteria | 918 |
| 50 | Ga0466734_041949 | 3300042623 | Bacteria | 1076 |
| 51 | Ga0123355_10020248 | 3300009826 | Bacteria | 10617 |
| 52 | Ga0123355_10089924 | 3300009826 | Bacteria | 4871 |
| 53 | Ga0123356_10306518 | 3300010049 | Bacteria | 1695 |
| 54 | Ga0123353_10661154 | 3300010167 | Bacteria | 1477 |
| 55 | Ga0123353_12163689 | 3300010167 | Bacteria | 674 |
| 56 | Ga0123353_12544713 | 3300010167 | Bacteria | 607 |
| 57 | Ga0466693_075974 | 3300042592 | Bacteria | 2538 |
| 58 | Ga0466705_102451 | 3300042612 | Bacteria | 8242 |
| 59 | Ga0466715_327423 | 3300042616 | Bacteria | 71223 |
| 60 | JGI24705J35276_12238803 | 3300002504 | Bacteria | 105587 |
| 61 | JGI24696J40584_12952216 | 3300002834 | Unclassified | 2320 |
| 62 | Ga0466703_064776 | 3300042636 | Bacteria | 55980 |
| 63 | Ga0466727_153941 | 3300042655 | Bacteria | 11273 |
| 64 | Ga0123355_10654459 | 3300009826 | Bacteria | 1225 |
| 65 | Ga0123355_11245671 | 3300009826 | Bacteria | 753 |
| 66 | Ga0123353_10412425 | 3300010167 | Bacteria | 2005 |
| 67 | Ga0415639_290978 | 3300038395 | Bacteria | 1274 |
| 68 | Ga0466693_202555 | 3300042592 | Bacteria | 1685 |
| 69 | Ga0466697_227906 | 3300042611 | Bacteria | 1476 |
| 70 | Ga0466705_258379 | 3300042612 | Bacteria | 1421 |
| 71 | Ga0466733_003554 | 3300042659 | Bacteria | 13220 |
| 72 | Ga0466715_107240 | 3300042616 | Bacteria | 39584 |
| 73 | Ga0466707_213812 | 3300042601 | Bacteria | 7351 |
| 74 | Ga0466713_134320 | 3300042602 | Bacteria | 10928 |
| 75 | IMNBL1DRAFT_c0001740 | 3300000062 | Bacteria | 15970 |
| 76 | JGI24705J35276_12137162 | 3300002504 | Bacteria | 1126 |
| 77 | Ga0103267_1000058 | 3300007190 | Bacteria | 85745 |
| 78 | Ga0466703_267134 | 3300042636 | Bacteria | 7483 |
| 79 | Ga0466704_208595 | 3300042643 | Bacteria | 15501 |
| 80 | Ga0466704_236369 | 3300042643 | Bacteria | 6051 |
| 81 | Ga0123357_10222850 | 3300009784 | Bacteria | 2087 |
| 82 | Ga0123355_10000832 | 3300009826 | Bacteria | 42380 |
| 83 | Ga0123355_10017538 | 3300009826 | Bacteria | 11319 |
| 84 | Ga0123355_10028847 | 3300009826 | Bacteria | 8976 |
| 85 | Ga0123355_11712746 | 3300009826 | Bacteria | 598 |
| 86 | Ga0123353_10000783 | 3300010167 | Bacteria | 38755 |
| 87 | Ga0466690_295401 | 3300042590 | Bacteria | 56577 |
| 88 | Ga0466692_100602 | 3300042591 | Bacteria | 6585 |
| 89 | Ga0466696_067545 | 3300042596 | Unclassified | 2478 |
| 90 | Ga0466733_006221 | 3300042659 | Bacteria | 5041 |
| 91 | Ga0466726_105886 | 3300042619 | Bacteria | 9690 |
| 92 | Ga0466701_050642 | 3300042598 | Bacteria | 1872 |
| 93 | Ga0466706_017683 | 3300042599 | Bacteria | 37282 |
| 94 | Ga0074278_111060 | 3300005721 | Bacteria | 125617 |
| 95 | Ga0466703_128612 | 3300042636 | Bacteria | 8956 |
| 96 | Ga0466725_077029 | 3300042654 | Bacteria | 14706 |
| 97 | Ga0123355_10186561 | 3300009826 | Bacteria | 3065 |
| 98 | Ga0123355_10282274 | 3300009826 | Bacteria | 2291 |
| 99 | Ga0123356_11543685 | 3300010049 | Bacteria | 820 |
| 100 | Ga0123354_10569770 | 3300010882 | Bacteria | 844 |
| 101 | Ga0466699_232219 | 3300042597 | Bacteria | 1366 |
| 102 | Ga0466710_378620 | 3300042613 | Bacteria | 1615 |
| 103 | Ga0466711_090744 | 3300042615 | Bacteria | 7555 |
| 104 | Ga0466711_240952 | 3300042615 | Bacteria | 3273 |
| 105 | Ga0466728_392314 | 3300042620 | Bacteria | 35765 |
| 106 | Ga0466700_492939 | 3300042600 | Bacteria | 1085 |
| 107 | Ga0466713_101230 | 3300042602 | Unclassified | 1043 |
| 108 | Ga0466719_346227 | 3300042606 | Bacteria | 1159 |
| 109 | Ga0466722_092243 | 3300042609 | Bacteria | 6997 |
| 110 | gam1t_NODE_96023_length=125607_GC=34_6_Contigs=2 | 2189573031 | Bacteria | 125617 |
| 111 | JGI24702J35022_10112966 | 3300002462 | Bacteria | 1495 |
| 112 | Ga0123356_10073216 | 3300010049 | Bacteria | 3221 |
| 113 | Ga0123353_10002340 | 3300010167 | Bacteria | 23545 |
| 114 | Ga0123354_10134952 | 3300010882 | Bacteria | 3092 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02580 | Tyr_Deacylase | D-Tyr-tRNA(Tyr) deacylase | 28 | 170 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.