Protein Family IF03107
Metagenome
Isolate
190
Members
50
Samples
177
Scaffolds
254.59
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10069430|Ga0123353_100694305
- Length
- 292 aa
- Sequence
- MDQTSNGPANNEPTKKEITIMANNKDTTTTAQDNLTQSTLITQTNSFTALAASDFSRMVSDEMDGLDIGFERIKIPSGGATMFELPGEGEDTETVKEFSGVILFHHTLNAYYKTKYTGGSNPPDCGSFDGITGEGDPGGECRTCRYNVFGTGENGSKACKNRRHVYILRENEVFPLLLSLPTGSLKTFTKYVKAQLSKGRKTNAIVTRFSLKKAVNATGIAYSQANFSLERILTPEEYAAVRSMSEQVRAYAQRVGLETDAVYEIDDNDNTTIDPETGEIIEPLNGGHRDV*
Sample Types
Isolate
4.2%
Metagenome
95.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.0%
Unclassified
18.4%
Kalotermitidae
16.3%
Rhinotermitidae
6.1%
Passalidae
4.1%
Termopsidae
4.1%
Hodotermitidae
2.0%
Taxonomy
Archaea
1
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
49
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 10 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 13 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 14 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 2820565217 | Unclassified Firmicutes Emb289P3bin51 | Isolate | Unclassified |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 42 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 43 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 44 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 45 | 2228664018 | Amitermes wheeleri hindgut microbial communities from Arizona, USA - 3 | Metagenome | Termitidae |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 47 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 48 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10157730 | 3300009826 | Bacteria | 3428 |
| 2 | Ga0123355_10341741 | 3300009826 | Bacteria | 1993 |
| 3 | Ga0123356_10004093 | 3300010049 | Bacteria | 15148 |
| 4 | Ga0123353_10002471 | 3300010167 | Bacteria | 22995 |
| 5 | Ga0123353_10040023 | 3300010167 | Bacteria | 7389 |
| 6 | Ga0123353_10069430 | 3300010167 | Bacteria | 5661 |
| 7 | Ga0123353_11195581 | 3300010167 | Bacteria | 998 |
| 8 | Ga0466706_214273 | 3300042599 | Unclassified | 6552 |
| 9 | Ga0466707_086392 | 3300042601 | Bacteria | 39745 |
| 10 | Ga0466714_048285 | 3300042603 | Bacteria | 2572 |
| 11 | Ga0466714_118313 | 3300042603 | Bacteria | 1625 |
| 12 | Ga0466717_237299 | 3300042604 | Unclassified | 2227 |
| 13 | Ga0466720_036523 | 3300042607 | Bacteria | 1235 |
| 14 | Ga0466710_429423 | 3300042613 | Bacteria | 1653 |
| 15 | Ga0466718_157899 | 3300042617 | Bacteria | 1825 |
| 16 | Ga0466726_245414 | 3300042619 | Bacteria | 2331 |
| 17 | Ga0466726_387409 | 3300042619 | Bacteria | 1170 |
| 18 | Ga0466703_365972 | 3300042636 | Bacteria | 1378 |
| 19 | Ga0466704_233537 | 3300042643 | Bacteria | 9586 |
| 20 | JGI24703J35330_11745543 | 3300002501 | Bacteria | 4636 |
| 21 | Ga0072940_1053521 | 3300005200 | Unclassified | 6340 |
| 22 | Ga0072940_1072231 | 3300005200 | Bacteria | 24578 |
| 23 | Ga0466693_136361 | 3300042592 | Bacteria | 2139 |
| 24 | Ga0123357_10261951 | 3300009784 | Unclassified | 1826 |
| 25 | Ga0123355_10037292 | 3300009826 | Bacteria | 7904 |
| 26 | Ga0123356_11220744 | 3300010049 | Bacteria | 917 |
| 27 | Ga0123353_10665807 | 3300010167 | Unclassified | 1470 |
| 28 | Ga0123353_10978509 | 3300010167 | Bacteria | 1140 |
| 29 | Ga0466706_033010 | 3300042599 | Bacteria | 38197 |
| 30 | Ga0466706_052139 | 3300042599 | Unclassified | 4510 |
| 31 | Ga0466706_076662 | 3300042599 | Bacteria | 5584 |
| 32 | Ga0466706_176037 | 3300042599 | Unclassified | 1598 |
| 33 | Ga0466706_220490 | 3300042599 | Bacteria | 222739 |
| 34 | Ga0466707_252571 | 3300042601 | Bacteria | 6386 |
| 35 | Ga0466707_366350 | 3300042601 | Bacteria | 2651 |
| 36 | Ga0466714_072465 | 3300042603 | Bacteria | 2313 |
| 37 | Ga0466716_541416 | 3300042605 | Unclassified | 3250 |
| 38 | Ga0466722_070080 | 3300042609 | Unclassified | 1311 |
| 39 | Ga0466722_073423 | 3300042609 | Bacteria | 2521 |
| 40 | Ga0466711_112588 | 3300042615 | Bacteria | 1669 |
| 41 | Ga0466715_244267 | 3300042616 | Bacteria | 51711 |
| 42 | Ga0466726_236417 | 3300042619 | Bacteria | 5000 |
| 43 | Ga0466731_059268 | 3300042622 | Bacteria | 1444 |
| 44 | IMNBL1DRAFT_c0005564 | 3300000062 | Bacteria | 7163 |
| 45 | Ga0466692_073041 | 3300042591 | Bacteria | 1533 |
| 46 | Ga0466692_126022 | 3300042591 | Bacteria | 1171 |
| 47 | Ga0466705_100877 | 3300042612 | Bacteria | 3677 |
| 48 | Ga0123355_10068167 | 3300009826 | Bacteria | 5725 |
| 49 | Ga0123356_10837510 | 3300010049 | Unclassified | 1091 |
| 50 | Ga0123353_10002568 | 3300010167 | Bacteria | 22564 |
| 51 | Ga0466706_005071 | 3300042599 | Bacteria | 1231 |
| 52 | Ga0466706_051343 | 3300042599 | Bacteria | 1625 |
| 53 | Ga0466706_057599 | 3300042599 | Unclassified | 2523 |
| 54 | Ga0466706_096194 | 3300042599 | Bacteria | 6052 |
| 55 | Ga0466706_237550 | 3300042599 | Unclassified | 1176 |
| 56 | Ga0466706_278589 | 3300042599 | Bacteria | 1991 |
| 57 | Ga0466700_445391 | 3300042600 | Unclassified | 1155 |
| 58 | Ga0466714_009108 | 3300042603 | Bacteria | 9935 |
| 59 | Ga0466714_079583 | 3300042603 | Bacteria | 9887 |
| 60 | Ga0466714_145568 | 3300042603 | Unclassified | 2262 |
| 61 | Ga0466722_066628 | 3300042609 | Bacteria | 1187 |
| 62 | Ga0466722_211142 | 3300042609 | Bacteria | 38695 |
| 63 | Ga0466698_089961 | 3300042610 | Bacteria | 3417 |
| 64 | Ga0466698_371572 | 3300042610 | Unclassified | 1874 |
| 65 | Ga0466698_408259 | 3300042610 | Bacteria | 1077 |
| 66 | Ga0466711_261513 | 3300042615 | Bacteria | 44460 |
| 67 | Ga0466711_352372 | 3300042615 | Bacteria | 1929 |
| 68 | Ga0466729_133078 | 3300042621 | Bacteria | 31387 |
| 69 | Ga0466729_187182 | 3300042621 | Bacteria | 2458 |
| 70 | Ga0466702_220414 | 3300042635 | Bacteria | 1066 |
| 71 | Ga0466703_350633 | 3300042636 | Bacteria | 2347 |
| 72 | 2227534362 | 2225789004 | Bacteria | 3089 |
| 73 | JGI24702J35022_10240998 | 3300002462 | Bacteria | 1049 |
| 74 | Ga0068305_10000565 | 3300005083 | Bacteria | 2635 |
| 75 | Ga0072941_1045081 | 3300005201 | Bacteria | 20126 |
| 76 | Ga0123353_10021951 | 3300010167 | Bacteria | 9600 |
| 77 | Ga0123353_10060086 | 3300010167 | Bacteria | 6096 |
| 78 | Ga0123353_10285093 | 3300010167 | Bacteria | 2533 |
| 79 | Ga0123353_10451848 | 3300010167 | Unclassified | 1891 |
| 80 | Ga0123353_10905290 | 3300010167 | Bacteria | 1200 |
| 81 | Ga0123353_11073248 | 3300010167 | Bacteria | 1073 |
| 82 | Ga0123354_10361666 | 3300010882 | Unclassified | 1279 |
| 83 | Ga0466706_199633 | 3300042599 | Unclassified | 1572 |
| 84 | Ga0466707_054007 | 3300042601 | Bacteria | 13863 |
| 85 | Ga0466714_103024 | 3300042603 | Unclassified | 1091 |
| 86 | Ga0466719_451000 | 3300042606 | Bacteria | 2627 |
| 87 | Ga0466715_274905 | 3300042616 | Bacteria | 3075 |
| 88 | Ga0466729_234527 | 3300042621 | Bacteria | 12197 |
| 89 | Ga0466709_403543 | 3300042648 | Bacteria | 3944 |
| 90 | Ga0466656_252849 | 3300042550 | Unclassified | 1593 |
| 91 | Ga0466692_111387 | 3300042591 | Unclassified | 1260 |
| 92 | Ga0466699_403839 | 3300042597 | Bacteria | 1038 |
| 93 | Ga0123355_10009651 | 3300009826 | Bacteria | 14708 |
| 94 | Ga0123356_10273083 | 3300010049 | Unclassified | 1781 |
| 95 | Ga0123356_10283029 | 3300010049 | Bacteria | 1754 |
| 96 | Ga0123353_10191470 | 3300010167 | Bacteria | 3228 |
| 97 | Ga0466701_032362 | 3300042598 | Unclassified | 1135 |
| 98 | Ga0466701_077714 | 3300042598 | Bacteria | 8048 |
| 99 | Ga0466706_263227 | 3300042599 | Bacteria | 1705 |
| 100 | Ga0466700_126135 | 3300042600 | Bacteria | 1073 |
| 101 | Ga0466714_118946 | 3300042603 | Bacteria | 4051 |
| 102 | Ga0466714_145151 | 3300042603 | Bacteria | 12146 |
| 103 | Ga0466722_082454 | 3300042609 | Bacteria | 1401 |
| 104 | Ga0466722_167018 | 3300042609 | Bacteria | 1194 |
| 105 | Ga0466731_155532 | 3300042622 | Bacteria | 1811 |
| 106 | Ga0466703_255188 | 3300042636 | Bacteria | 10608 |
| 107 | IMNBL1DRAFT_c0010282 | 3300000062 | Bacteria | 4509 |
| 108 | Ga0072940_1009018 | 3300005200 | Bacteria | 2890 |
| 109 | Ga0072940_1059067 | 3300005200 | Bacteria | 2662 |
| 110 | Ga0072940_1129028 | 3300005200 | Bacteria | 10574 |
| 111 | Ga0072941_1325038 | 3300005201 | Bacteria | 2562 |
| 112 | Ga0123355_10215726 | 3300009826 | Bacteria | 2771 |
| 113 | Ga0123356_10052683 | 3300010049 | Bacteria | 3786 |
| 114 | Ga0123353_10001086 | 3300010167 | Bacteria | 33084 |
| 115 | Ga0123353_10005311 | 3300010167 | Unclassified | 16868 |
| 116 | Ga0123353_10030323 | 3300010167 | Bacteria | 8357 |
| 117 | Ga0123353_10130725 | 3300010167 | Bacteria | 4029 |
| 118 | Ga0123353_10146168 | 3300010167 | Bacteria | 3780 |
| 119 | Ga0123353_10313900 | 3300010167 | Bacteria | 2383 |
| 120 | Ga0466706_005286 | 3300042599 | Bacteria | 2686 |
| 121 | Ga0466706_034849 | 3300042599 | Bacteria | 22213 |
| 122 | Ga0466706_043111 | 3300042599 | Unclassified | 12038 |
| 123 | Ga0466706_095134 | 3300042599 | Unclassified | 1797 |
| 124 | Ga0466706_137158 | 3300042599 | Unclassified | 1890 |
| 125 | Ga0466706_182144 | 3300042599 | Unclassified | 16511 |
| 126 | Ga0466706_280809 | 3300042599 | Unclassified | 2771 |
| 127 | Ga0466700_162464 | 3300042600 | Bacteria | 1238 |
| 128 | Ga0466714_062170 | 3300042603 | Unclassified | 1381 |
| 129 | Ga0466717_231916 | 3300042604 | Unclassified | 1015 |
| 130 | Ga0466722_268215 | 3300042609 | Unclassified | 2342 |
| 131 | Ga0466726_072312 | 3300042619 | Bacteria | 4903 |
| 132 | Ga0466726_263997 | 3300042619 | Bacteria | 2447 |
| 133 | Ga0466735_133523 | 3300042624 | Archaea | 2936 |
| 134 | Ga0466704_243886 | 3300042643 | Bacteria | 5875 |
| 135 | Ga0466704_436235 | 3300042643 | Bacteria | 17075 |
| 136 | AmiMGMT1_c263870 | 2228664018 | Bacteria | 756 |
| 137 | IMNBL1DRAFT_c0031208 | 3300000062 | Bacteria | 1941 |
| 138 | JGI24702J35022_10255405 | 3300002462 | Bacteria | 1021 |
| 139 | Ga0466692_176867 | 3300042591 | Bacteria | 2657 |
| 140 | Ga0466693_160460 | 3300042592 | Bacteria | 1037 |
| 141 | Ga0123355_10074904 | 3300009826 | Bacteria | 5420 |
| 142 | Ga0123356_10000288 | 3300010049 | Bacteria | 57856 |
| 143 | Ga0466706_031439 | 3300042599 | Unclassified | 3711 |
| 144 | Ga0466706_055884 | 3300042599 | Bacteria | 25268 |
| 145 | Ga0466706_060489 | 3300042599 | Unclassified | 8879 |
| 146 | Ga0466706_182973 | 3300042599 | Unclassified | 7156 |
| 147 | Ga0466706_274793 | 3300042599 | Bacteria | 2921 |
| 148 | Ga0466706_277305 | 3300042599 | Unclassified | 1232 |
| 149 | Ga0466714_128152 | 3300042603 | Bacteria | 6203 |
| 150 | Ga0466714_165464 | 3300042603 | Bacteria | 1320 |
| 151 | Ga0466722_092120 | 3300042609 | Unclassified | 1052 |
| 152 | Ga0466722_229422 | 3300042609 | Unclassified | 1817 |
| 153 | Ga0466722_236881 | 3300042609 | Unclassified | 1543 |
| 154 | Ga0466729_082700 | 3300042621 | Bacteria | 13858 |
| 155 | Ga0466725_348177 | 3300042654 | Bacteria | 1738 |
| 156 | IMNBL1DRAFT_c0002090 | 3300000062 | Bacteria | 14214 |
| 157 | Ga0466656_015788 | 3300042550 | Unclassified | 1449 |
| 158 | Ga0123357_10070576 | 3300009784 | Bacteria | 4637 |
| 159 | Ga0123356_10026469 | 3300010049 | Bacteria | 5444 |
| 160 | Ga0123356_10130624 | 3300010049 | Bacteria | 2460 |
| 161 | Ga0123353_10351349 | 3300010167 | Bacteria | 2221 |
| 162 | Ga0123353_10810085 | 3300010167 | Unclassified | 1291 |
| 163 | Ga0123353_10892773 | 3300010167 | Bacteria | 1211 |
| 164 | Ga0466701_046742 | 3300042598 | Bacteria | 1248 |
| 165 | Ga0466706_057425 | 3300042599 | Unclassified | 2035 |
| 166 | Ga0466706_211010 | 3300042599 | Bacteria | 1055 |
| 167 | Ga0466714_062751 | 3300042603 | Unclassified | 1443 |
| 168 | Ga0466717_236482 | 3300042604 | Bacteria | 3260 |
| 169 | Ga0466719_406038 | 3300042606 | Unclassified | 1884 |
| 170 | Ga0466698_124955 | 3300042610 | Bacteria | 2673 |
| 171 | Ga0466726_471753 | 3300042619 | Bacteria | 19847 |
| 172 | Ga0466704_339425 | 3300042643 | Bacteria | 3858 |
| 173 | AustNasuHG_c1008615 | 3300000089 | Bacteria | 3608 |
| 174 | Ga0072940_1017679 | 3300005200 | Bacteria | 7382 |
| 175 | Ga0466656_090110 | 3300042550 | Bacteria | 2167 |
| 176 | Ga0466656_293203 | 3300042550 | Bacteria | 1432 |
| 177 | Ga0466693_088419 | 3300042592 | Bacteria | 1232 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 2228664018 | AmiMGMT1_c263870 | AmiMGMT1_2638701 | 199 |
| 2 | 3300042609 | Ga0466722_229422 | Ga0466722_229422_563_1291 | 217 |
| 3 | 3300042635 | Ga0466702_220414 | Ga0466702_220414_167_847 | 226 |
| 4 | 3300010167 | Ga0123353_10040023 | Ga0123353_100400237 | 229 |
| 5 | 3300010167 | Ga0123353_10665807 | Ga0123353_106658072 | 230 |
| 6 | 3300042599 | Ga0466706_031439 | Ga0466706_031439_1032_1796 | 230 |
| 7 | 3300042610 | Ga0466698_371572 | Ga0466698_371572_175_876 | 233 |
| 8 | 3300005200 | Ga0072940_1017679 | Ga0072940_10176796 | 234 |
| 9 | 3300009826 | Ga0123355_10009651 | Ga0123355_100096515 | 235 |
| 10 | 3300042604 | Ga0466717_231916 | Ga0466717_231916_288_1004 | 238 |
| 11 | 3300042604 | Ga0466717_237299 | Ga0466717_237299_924_1640 | 238 |
| 12 | 3300010167 | Ga0123353_10146168 | Ga0123353_101461682 | 239 |
| 13 | iso_pr_bacteria | 2820705605 | 2820705624 | 239 |
| 14 | 3300042598 | Ga0466701_046742 | Ga0466701_046742_410_1162 | 240 |
| 15 | 3300005200 | Ga0072940_1059067 | Ga0072940_10590673 | 241 |
| 16 | 3300005200 | Ga0072940_1059067 | Ga0072940_10590673 | 241 |
| 17 | 3300042592 | Ga0466693_160460 | Ga0466693_160460_129_854 | 241 |
| 18 | 3300010049 | Ga0123356_10273083 | Ga0123356_102730834 | 242 |
| 19 | 3300010167 | Ga0123353_11195581 | Ga0123353_111955812 | 242 |
| 20 | 3300042550 | Ga0466656_293203 | Ga0466656_293203_317_1051 | 244 |
| 21 | 3300042612 | Ga0466705_100877 | Ga0466705_100877_1788_2525 | 245 |
| 22 | 3300042599 | Ga0466706_033010 | Ga0466706_033010_20359_21099 | 246 |
| 23 | 3300042603 | Ga0466714_062751 | Ga0466714_062751_124_864 | 246 |
| 24 | 3300042619 | Ga0466726_387409 | Ga0466726_387409_243_1013 | 246 |
| 25 | iso_pr_bacteria | 2820474468 | 2820476586 | 246 |
| 26 | 3300009784 | Ga0123357_10070576 | Ga0123357_100705762 | 247 |
| 27 | 3300042600 | Ga0466700_162464 | Ga0466700_162464_244_987 | 247 |
| 28 | 3300042603 | Ga0466714_009108 | Ga0466714_009108_4238_4981 | 247 |
| 29 | 3300042613 | Ga0466710_429423 | Ga0466710_429423_752_1495 | 247 |
| 30 | 3300010049 | Ga0123356_10283029 | Ga0123356_102830292 | 249 |
| 31 | 3300010167 | Ga0123353_10002471 | Ga0123353_1000247112 | 249 |
| 32 | 3300010167 | Ga0123353_10002568 | Ga0123353_1000256815 | 249 |
| 33 | 3300042599 | Ga0466706_096194 | Ga0466706_096194_593_1417 | 249 |
| 34 | 3300042603 | Ga0466714_118313 | Ga0466714_118313_427_1176 | 249 |
| 35 | iso_pr_bacteria | 2820389254 | 2820391233 | 249 |
| 36 | 3300010049 | Ga0123356_11220744 | Ga0123356_112207442 | 250 |
| 37 | 3300010167 | Ga0123353_10021951 | Ga0123353_100219513 | 250 |
| 38 | 3300042597 | Ga0466699_403839 | Ga0466699_403839_157_909 | 250 |
| 39 | 3300042599 | Ga0466706_076662 | Ga0466706_076662_1141_1893 | 250 |
| 40 | 3300042607 | Ga0466720_036523 | Ga0466720_036523_344_1096 | 250 |
| 41 | 3300042619 | Ga0466726_245414 | Ga0466726_245414_1128_1880 | 250 |
| 42 | 3300042622 | Ga0466731_059268 | Ga0466731_059268_673_1425 | 250 |
| 43 | iso_pr_bacteria | 2820389254 | 2820390824 | 250 |
| 44 | 3300005201 | Ga0072941_1045081 | Ga0072941_10450819 | 251 |
| 45 | 3300042603 | Ga0466714_118946 | Ga0466714_118946_1108_1863 | 251 |
| 46 | 3300042605 | Ga0466716_541416 | Ga0466716_541416_2030_2785 | 251 |
| 47 | 3300002462 | JGI24702J35022_10255405 | JGI24702J35022_102554051 | 252 |
| 48 | 3300005083 | Ga0068305_10000565 | Ga0068305_100005653 | 252 |
| 49 | 3300005083 | Ga0068305_10000565 | Ga0068305_100005653 | 252 |
| 50 | 3300009826 | Ga0123355_10068167 | Ga0123355_100681674 | 252 |
| 51 | 3300009826 | Ga0123355_10068167 | Ga0123355_100681674 | 252 |
| 52 | 3300010049 | Ga0123356_10052683 | Ga0123356_100526832 | 252 |
| 53 | 3300010167 | Ga0123353_10905290 | Ga0123353_109052902 | 252 |
| 54 | 3300042601 | Ga0466707_054007 | Ga0466707_054007_10583_11341 | 252 |
| 55 | 3300042603 | Ga0466714_062170 | Ga0466714_062170_421_1179 | 252 |
| 56 | 3300042603 | Ga0466714_165464 | Ga0466714_165464_25_783 | 252 |
| 57 | 3300042609 | Ga0466722_066628 | Ga0466722_066628_402_1160 | 252 |
| 58 | 3300042609 | Ga0466722_092120 | Ga0466722_092120_231_989 | 252 |
| 59 | 3300042609 | Ga0466722_236881 | Ga0466722_236881_46_804 | 252 |
| 60 | 3300042619 | Ga0466726_236417 | Ga0466726_236417_176_934 | 252 |
| 61 | iso_pr_bacteria | 2820565217 | 2820565966 | 252 |
| 62 | 3300010049 | Ga0123356_10026469 | Ga0123356_100264693 | 253 |
| 63 | 3300010167 | Ga0123353_10030323 | Ga0123353_100303237 | 253 |
| 64 | 3300010882 | Ga0123354_10361666 | Ga0123354_103616662 | 253 |
| 65 | 3300042592 | Ga0466693_088419 | Ga0466693_088419_15_776 | 253 |
| 66 | 3300042599 | Ga0466706_060489 | Ga0466706_060489_3348_4109 | 253 |
| 67 | 3300042599 | Ga0466706_211010 | Ga0466706_211010_211_972 | 253 |
| 68 | 3300042599 | Ga0466706_214273 | Ga0466706_214273_617_1441 | 253 |
| 69 | 3300042599 | Ga0466706_237550 | Ga0466706_237550_162_923 | 253 |
| 70 | 3300042621 | Ga0466729_082700 | Ga0466729_082700_6641_7402 | 253 |
| 71 | 3300042648 | Ga0466709_403543 | Ga0466709_403543_618_1379 | 253 |
| 72 | 3300010167 | Ga0123353_10892773 | Ga0123353_108927732 | 254 |
| 73 | 3300042591 | Ga0466692_176867 | Ga0466692_176867_1771_2535 | 254 |
| 74 | 3300042599 | Ga0466706_051343 | Ga0466706_051343_732_1496 | 254 |
| 75 | 3300042599 | Ga0466706_055884 | Ga0466706_055884_17573_18337 | 254 |
| 76 | 3300042599 | Ga0466706_057599 | Ga0466706_057599_1630_2394 | 254 |
| 77 | 3300042599 | Ga0466706_137158 | Ga0466706_137158_724_1488 | 254 |
| 78 | 3300042599 | Ga0466706_199633 | Ga0466706_199633_96_860 | 254 |
| 79 | 3300042599 | Ga0466706_274793 | Ga0466706_274793_168_932 | 254 |
| 80 | 3300042599 | Ga0466706_277305 | Ga0466706_277305_167_931 | 254 |
| 81 | 3300042603 | Ga0466714_145568 | Ga0466714_145568_68_832 | 254 |
| 82 | 3300042609 | Ga0466722_167018 | Ga0466722_167018_403_1167 | 254 |
| 83 | 3300042609 | Ga0466722_268215 | Ga0466722_268215_797_1561 | 254 |
| 84 | 3300042615 | Ga0466711_112588 | Ga0466711_112588_675_1439 | 254 |
| 85 | 3300042616 | Ga0466715_274905 | Ga0466715_274905_171_935 | 254 |
| 86 | 3300042643 | Ga0466704_436235 | Ga0466704_436235_12648_13412 | 254 |
| 87 | 3300005200 | Ga0072940_1009018 | Ga0072940_10090183 | 255 |
| 88 | 3300042591 | Ga0466692_111387 | Ga0466692_111387_365_1132 | 255 |
| 89 | 3300042599 | Ga0466706_034849 | Ga0466706_034849_2359_3126 | 255 |
| 90 | 3300042599 | Ga0466706_043111 | Ga0466706_043111_9472_10239 | 255 |
| 91 | 3300042599 | Ga0466706_052139 | Ga0466706_052139_2369_3136 | 255 |
| 92 | 3300042599 | Ga0466706_057425 | Ga0466706_057425_634_1401 | 255 |
| 93 | 3300042599 | Ga0466706_095134 | Ga0466706_095134_817_1584 | 255 |
| 94 | 3300042599 | Ga0466706_182973 | Ga0466706_182973_5393_6160 | 255 |
| 95 | 3300042599 | Ga0466706_278589 | Ga0466706_278589_650_1417 | 255 |
| 96 | 3300042599 | Ga0466706_280809 | Ga0466706_280809_756_1523 | 255 |
| 97 | 3300042603 | Ga0466714_103024 | Ga0466714_103024_205_972 | 255 |
| 98 | 3300042603 | Ga0466714_128152 | Ga0466714_128152_4117_4884 | 255 |
| 99 | 3300042616 | Ga0466715_244267 | Ga0466715_244267_21527_22294 | 255 |
| 100 | 2225789004 | 2227534362 | 2228049263 | 256 |
| 101 | 3300005200 | Ga0072940_1053521 | Ga0072940_10535216 | 256 |
| 102 | 3300042599 | Ga0466706_182144 | Ga0466706_182144_7982_8752 | 256 |
| 103 | 3300042621 | Ga0466729_234527 | Ga0466729_234527_9667_10437 | 256 |
| 104 | 3300042636 | Ga0466703_350633 | Ga0466703_350633_328_1098 | 256 |
| 105 | 3300000062 | IMNBL1DRAFT_c0010282 | IMNBL1DRAFT_00102824 | 257 |
| 106 | 3300000062 | IMNBL1DRAFT_c0031208 | IMNBL1DRAFT_00312081 | 257 |
| 107 | 3300000089 | AustNasuHG_c1008615 | AustNasuHG_10086153 | 257 |
| 108 | 3300000089 | AustNasuHG_c1008615 | AustNasuHG_10086153 | 257 |
| 109 | 3300002462 | JGI24702J35022_10240998 | JGI24702J35022_102409981 | 257 |
| 110 | 3300010049 | Ga0123356_10000288 | Ga0123356_1000028846 | 257 |
| 111 | 3300010049 | Ga0123356_10004093 | Ga0123356_1000409314 | 257 |
| 112 | 3300010167 | Ga0123353_10451848 | Ga0123353_104518482 | 257 |
| 113 | 3300042550 | Ga0466656_015788 | Ga0466656_015788_170_943 | 257 |
| 114 | 3300042599 | Ga0466706_005286 | Ga0466706_005286_1667_2440 | 257 |
| 115 | 3300042603 | Ga0466714_079583 | Ga0466714_079583_3576_4349 | 257 |
| 116 | 3300042606 | Ga0466719_451000 | Ga0466719_451000_1450_2223 | 257 |
| 117 | 3300042609 | Ga0466722_082454 | Ga0466722_082454_244_1017 | 257 |
| 118 | 3300042624 | Ga0466735_133523 | Ga0466735_133523_976_1749 | 257 |
| 119 | 3300009826 | Ga0123355_10215726 | Ga0123355_102157263 | 258 |
| 120 | 3300009826 | Ga0123355_10215726 | Ga0123355_102157263 | 258 |
| 121 | 3300010049 | Ga0123356_10130624 | Ga0123356_101306242 | 258 |
| 122 | 3300010049 | Ga0123356_10837510 | Ga0123356_108375102 | 258 |
| 123 | 3300010167 | Ga0123353_10130725 | Ga0123353_101307253 | 258 |
| 124 | 3300042599 | Ga0466706_176037 | Ga0466706_176037_567_1343 | 258 |
| 125 | 3300042599 | Ga0466706_263227 | Ga0466706_263227_226_1002 | 258 |
| 126 | 3300042604 | Ga0466717_236482 | Ga0466717_236482_1268_2044 | 258 |
| 127 | iso_pr_bacteria | 2820362221 | 2820362294 | 258 |
| 128 | 3300009784 | Ga0123357_10261951 | Ga0123357_102619513 | 259 |
| 129 | 3300009826 | Ga0123355_10037292 | Ga0123355_100372924 | 259 |
| 130 | 3300009826 | Ga0123355_10341741 | Ga0123355_103417413 | 259 |
| 131 | 3300042591 | Ga0466692_126022 | Ga0466692_126022_358_1137 | 259 |
| 132 | 3300042600 | Ga0466700_445391 | Ga0466700_445391_100_879 | 259 |
| 133 | 3300042606 | Ga0466719_406038 | Ga0466719_406038_170_949 | 259 |
| 134 | 3300042609 | Ga0466722_073423 | Ga0466722_073423_22_801 | 259 |
| 135 | 3300042610 | Ga0466698_408259 | Ga0466698_408259_229_1008 | 259 |
| 136 | 3300042617 | Ga0466718_157899 | Ga0466718_157899_86_865 | 259 |
| 137 | 3300042621 | Ga0466729_187182 | Ga0466729_187182_218_997 | 259 |
| 138 | 3300042643 | Ga0466704_243886 | Ga0466704_243886_4456_5235 | 259 |
| 139 | 3300042643 | Ga0466704_339425 | Ga0466704_339425_2439_3218 | 259 |
| 140 | 3300042654 | Ga0466725_348177 | Ga0466725_348177_428_1207 | 259 |
| 141 | 3300005200 | Ga0072940_1072231 | Ga0072940_107223122 | 260 |
| 142 | 3300005201 | Ga0072941_1325038 | Ga0072941_13250382 | 260 |
| 143 | 3300010167 | Ga0123353_10001086 | Ga0123353_1000108632 | 260 |
| 144 | 3300010167 | Ga0123353_10978509 | Ga0123353_109785092 | 260 |
| 145 | 3300042599 | Ga0466706_005071 | Ga0466706_005071_33_815 | 260 |
| 146 | 3300042600 | Ga0466700_126135 | Ga0466700_126135_97_879 | 260 |
| 147 | 3300042601 | Ga0466707_086392 | Ga0466707_086392_8606_9388 | 260 |
| 148 | 3300042609 | Ga0466722_211142 | Ga0466722_211142_33986_34768 | 260 |
| 149 | 3300042619 | Ga0466726_471753 | Ga0466726_471753_2485_3267 | 260 |
| 150 | 3300000062 | IMNBL1DRAFT_c0005564 | IMNBL1DRAFT_00055646 | 261 |
| 151 | 3300010167 | Ga0123353_10351349 | Ga0123353_103513492 | 261 |
| 152 | 3300042550 | Ga0466656_252849 | Ga0466656_252849_723_1508 | 261 |
| 153 | 3300042591 | Ga0466692_073041 | Ga0466692_073041_733_1518 | 261 |
| 154 | 3300042603 | Ga0466714_048285 | Ga0466714_048285_1766_2551 | 261 |
| 155 | 3300042619 | Ga0466726_072312 | Ga0466726_072312_3283_4068 | 261 |
| 156 | 3300042621 | Ga0466729_133078 | Ga0466729_133078_4202_4987 | 261 |
| 157 | iso_pr_bacteria | 2820424542 | 2820426281 | 261 |
| 158 | 3300010167 | Ga0123353_10005311 | Ga0123353_100053117 | 262 |
| 159 | 3300042592 | Ga0466693_136361 | Ga0466693_136361_651_1439 | 262 |
| 160 | 3300042599 | Ga0466706_220490 | Ga0466706_220490_26622_27410 | 262 |
| 161 | 3300042610 | Ga0466698_124955 | Ga0466698_124955_1056_1844 | 262 |
| 162 | 3300042619 | Ga0466726_263997 | Ga0466726_263997_853_1641 | 262 |
| 163 | 3300042643 | Ga0466704_233537 | Ga0466704_233537_1766_2554 | 262 |
| 164 | 3300000062 | IMNBL1DRAFT_c0002090 | IMNBL1DRAFT_000209011 | 263 |
| 165 | 3300010167 | Ga0123353_10060086 | Ga0123353_100600864 | 263 |
| 166 | 3300010167 | Ga0123353_10191470 | Ga0123353_101914702 | 263 |
| 167 | 3300010167 | Ga0123353_10285093 | Ga0123353_102850932 | 263 |
| 168 | 3300010167 | Ga0123353_10313900 | Ga0123353_103139002 | 263 |
| 169 | 3300010167 | Ga0123353_10810085 | Ga0123353_108100852 | 263 |
| 170 | 3300042598 | Ga0466701_032362 | Ga0466701_032362_180_971 | 263 |
| 171 | 3300042615 | Ga0466711_261513 | Ga0466711_261513_3046_3837 | 263 |
| 172 | 3300042636 | Ga0466703_255188 | Ga0466703_255188_2827_3618 | 263 |
| 173 | 3300009826 | Ga0123355_10074904 | Ga0123355_100749047 | 264 |
| 174 | 3300042550 | Ga0466656_090110 | Ga0466656_090110_1007_1801 | 264 |
| 175 | 3300042622 | Ga0466731_155532 | Ga0466731_155532_536_1357 | 264 |
| 176 | iso_pr_bacteria | 2820378768 | 2820379642 | 264 |
| 177 | 3300002501 | JGI24703J35330_11745543 | JGI24703J35330_117455432 | 265 |
| 178 | 3300042603 | Ga0466714_072465 | Ga0466714_072465_1308_2108 | 266 |
| 179 | 3300042610 | Ga0466698_089961 | Ga0466698_089961_1370_2170 | 266 |
| 180 | 3300042615 | Ga0466711_352372 | Ga0466711_352372_488_1288 | 266 |
| 181 | 3300042636 | Ga0466703_365972 | Ga0466703_365972_502_1302 | 266 |
| 182 | 3300005200 | Ga0072940_1129028 | Ga0072940_11290287 | 268 |
| 183 | 3300042601 | Ga0466707_252571 | Ga0466707_252571_1266_2072 | 268 |
| 184 | 3300042601 | Ga0466707_366350 | Ga0466707_366350_345_1151 | 268 |
| 185 | 3300010167 | Ga0123353_11073248 | Ga0123353_110732482 | 272 |
| 186 | 3300042603 | Ga0466714_145151 | Ga0466714_145151_2762_3583 | 273 |
| 187 | 3300042609 | Ga0466722_070080 | Ga0466722_070080_430_1257 | 275 |
| 188 | 3300009826 | Ga0123355_10157730 | Ga0123355_101577303 | 279 |
| 189 | 3300042598 | Ga0466701_077714 | Ga0466701_077714_795_1640 | 281 |
| 190 | 3300010167 | Ga0123353_10069430 | Ga0123353_100694305 | 292 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.7 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.