Protein Family IF03087
Metagenome
Isolate
275
Members
125
Samples
209
Scaffolds
50.91
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10034722|Ga0123353_100347224
- Length
- 55 aa
- Sequence
- MAMKRTYQPSNRRRKNKHGFRERMATANGRRVLAARRAKGRKKVTVSDENPEKK*
Sample Types
Isolate
24.0%
Metagenome
76.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
23.6%
Termitidae
21.1%
Kalotermitidae
11.4%
Unclassified
9.8%
Cryptocercidae
9.8%
Blaberidae
4.9%
Rhinotermitidae
3.3%
Termopsidae
3.3%
Passalidae
2.4%
Drosophilidae
2.4%
Anaplectidae
1.6%
Pseudophyllodromiidae
1.6%
Nyctiboridae
1.6%
Hydrophilidae
0.8%
Hodotermitidae
0.8%
Blattellidae
0.8%
Tenebrionidae
0.8%
Taxonomy
Archaea
0
Bacteria
214
Eukaryota
0
Viruses
0
Unclassified
61
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 2 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 3 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 4 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 5 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 6 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 7 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 8 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 9 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 10 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 11 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 12 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 13 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 22 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 23 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 24 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 25 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 26 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 27 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 28 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 29 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 30 | 3300005308 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 1 gut | Metagenome | Drosophilidae |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 35 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 36 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 37 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 38 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 39 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 40 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 41 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 44 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 45 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 46 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 47 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 48 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 51 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 52 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 53 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 54 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 55 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 56 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 57 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 58 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 59 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 60 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 61 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 62 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 63 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 64 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 65 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 66 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 67 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 68 | 3002004631 | Blattabacterium cuenoti ANAPome | Isolate | Anaplectidae |
| 69 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 70 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 71 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 72 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 73 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 74 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 75 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 76 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 77 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 78 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 79 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 80 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 81 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 82 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 83 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 84 | 3002008367 | Blattabacterium cuenoti PARANAUcir | Isolate | Blaberidae |
| 85 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 86 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 87 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 88 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 89 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 90 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 91 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 92 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 93 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 94 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 95 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 96 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 97 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 98 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 99 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 100 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 101 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 102 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 103 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 104 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 105 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 106 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 107 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 108 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 109 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 110 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 111 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 112 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 113 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 114 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 115 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 116 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 117 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 118 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 119 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 120 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 121 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 122 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 123 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 124 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 125 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_045085 | 3300042612 | Bacteria | 9322 |
| 2 | Ga0466733_055799 | 3300042659 | Bacteria | 106016 |
| 3 | Ga0466733_132962 | 3300042659 | Bacteria | 36267 |
| 4 | Ga0466715_454915 | 3300042616 | Bacteria | 11790 |
| 5 | Ga0466726_196966 | 3300042619 | Bacteria | 4165 |
| 6 | Ga0123356_10008777 | 3300010049 | Unclassified | 10017 |
| 7 | Ga0123356_10075619 | 3300010049 | Unclassified | 3173 |
| 8 | Ga0123356_11588798 | 3300010049 | Bacteria | 809 |
| 9 | Ga0123353_10506440 | 3300010167 | Bacteria | 1757 |
| 10 | Ga0466690_072297 | 3300042590 | Bacteria | 20312 |
| 11 | Ga0466691_034658 | 3300042593 | Bacteria | 6378 |
| 12 | Ga0466706_064728 | 3300042599 | Bacteria | 82048 |
| 13 | Ga0466706_239589 | 3300042599 | Bacteria | 25412 |
| 14 | Ga0466713_024971 | 3300042602 | Bacteria | 11465 |
| 15 | Ga0466714_070902 | 3300042603 | Unclassified | 3624 |
| 16 | Ga0466716_452133 | 3300042605 | Bacteria | 2619 |
| 17 | Ga0466719_036510 | 3300042606 | Bacteria | 25328 |
| 18 | Ga0466735_064609 | 3300042624 | Unclassified | 4180 |
| 19 | Ga0466735_150195 | 3300042624 | Bacteria | 3480 |
| 20 | Ga0466735_159718 | 3300042624 | Unclassified | 2122 |
| 21 | Ga0466735_195667 | 3300042624 | Unclassified | 1526 |
| 22 | Ga0466735_230752 | 3300042624 | Bacteria | 1008 |
| 23 | 2227367509 | 2225789004 | Bacteria | 1118 |
| 24 | IMNBL1DRAFT_c0006969 | 3300000062 | Bacteria | 6047 |
| 25 | IMNBL1DRAFT_c0066247 | 3300000062 | Unclassified | 1061 |
| 26 | JGI24702J35022_10022113 | 3300002462 | Bacteria | 3446 |
| 27 | JGI24702J35022_10335696 | 3300002462 | Unclassified | 900 |
| 28 | JGI24696J40584_12690454 | 3300002834 | Bacteria | 728 |
| 29 | Ga0466710_053618 | 3300042613 | Bacteria | 1168 |
| 30 | Ga0466710_334896 | 3300042613 | Bacteria | 6592 |
| 31 | Ga0466711_067717 | 3300042615 | Bacteria | 28249 |
| 32 | Ga0466711_496117 | 3300042615 | Bacteria | 4324 |
| 33 | Ga0466715_626889 | 3300042616 | Bacteria | 16292 |
| 34 | Ga0466718_011592 | 3300042617 | Unclassified | 1910 |
| 35 | Ga0466723_350368 | 3300042618 | Unclassified | 5533 |
| 36 | Ga0123353_10227145 | 3300010167 | Bacteria | 2914 |
| 37 | Ga0123353_10414068 | 3300010167 | Bacteria | 2000 |
| 38 | Ga0466656_120950 | 3300042550 | Bacteria | 9575 |
| 39 | Ga0466694_357660 | 3300042594 | Bacteria | 3964 |
| 40 | Ga0466706_117449 | 3300042599 | Bacteria | 20679 |
| 41 | Ga0466706_233555 | 3300042599 | Bacteria | 45210 |
| 42 | Ga0466707_250935 | 3300042601 | Unclassified | 1036 |
| 43 | Ga0466707_312039 | 3300042601 | Bacteria | 9254 |
| 44 | Ga0466713_050514 | 3300042602 | Bacteria | 48976 |
| 45 | Ga0466719_072882 | 3300042606 | Bacteria | 12516 |
| 46 | Ga0466731_336997 | 3300042622 | Bacteria | 40948 |
| 47 | Ga0466735_180093 | 3300042624 | Unclassified | 1577 |
| 48 | Ga0466704_230455 | 3300042643 | Bacteria | 5728 |
| 49 | IMNBL1DRAFT_c0004630 | 3300000062 | Bacteria | 8182 |
| 50 | IMNBL1DRAFT_c0006767 | 3300000062 | Bacteria | 6188 |
| 51 | IMNBL1DRAFT_c0070485 | 3300000062 | Bacteria | 1010 |
| 52 | JGI24705J35276_12237354 | 3300002504 | Bacteria | 10794 |
| 53 | Ga0068305_10814626 | 3300005083 | Bacteria | 607 |
| 54 | Ga0123357_10000101 | 3300009784 | Bacteria | 70940 |
| 55 | Ga0466697_099316 | 3300042611 | Unclassified | 1282 |
| 56 | Ga0466732_210198 | 3300042656 | Bacteria | 3836 |
| 57 | Ga0466733_078806 | 3300042659 | Bacteria | 7143 |
| 58 | Ga0466733_086105 | 3300042659 | Unclassified | 1764 |
| 59 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 60 | Ga0466715_165468 | 3300042616 | Bacteria | 7150 |
| 61 | Ga0123355_10002576 | 3300009826 | Bacteria | 25712 |
| 62 | Ga0123353_10092093 | 3300010167 | Bacteria | 4882 |
| 63 | Ga0123353_12611041 | 3300010167 | Bacteria | 597 |
| 64 | Ga0466656_388339 | 3300042550 | Bacteria | 2450 |
| 65 | Ga0466690_214427 | 3300042590 | Unclassified | 3016 |
| 66 | Ga0466693_259645 | 3300042592 | Unclassified | 1019 |
| 67 | Ga0466691_060692 | 3300042593 | Bacteria | 22870 |
| 68 | Ga0466696_033403 | 3300042596 | Bacteria | 5157 |
| 69 | Ga0466696_077671 | 3300042596 | Bacteria | 18917 |
| 70 | Ga0466696_129002 | 3300042596 | Bacteria | 5473 |
| 71 | Ga0466696_379309 | 3300042596 | Unclassified | 3756 |
| 72 | Ga0466701_090148 | 3300042598 | Bacteria | 5004 |
| 73 | Ga0466722_198958 | 3300042609 | Unclassified | 2420 |
| 74 | Ga0466735_221908 | 3300042624 | Unclassified | 1089 |
| 75 | Ga0466703_128091 | 3300042636 | Bacteria | 19176 |
| 76 | Ga0466703_250246 | 3300042636 | Unclassified | 1550 |
| 77 | Ga0466704_557613 | 3300042643 | Unclassified | 2690 |
| 78 | Ga0068305_10119571 | 3300005083 | Unclassified | 2908 |
| 79 | Ga0123357_10002060 | 3300009784 | Bacteria | 22051 |
| 80 | Ga0466697_132580 | 3300042611 | Unclassified | 1646 |
| 81 | Ga0466733_030455 | 3300042659 | Bacteria | 39544 |
| 82 | Ga0466710_176092 | 3300042613 | Bacteria | 2225 |
| 83 | Ga0466715_502204 | 3300042616 | Unclassified | 1164 |
| 84 | Ga0123357_10004643 | 3300009784 | Bacteria | 16204 |
| 85 | Ga0123356_10959010 | 3300010049 | Bacteria | 1026 |
| 86 | Ga0123353_10034722 | 3300010167 | Bacteria | 7878 |
| 87 | Ga0123353_10470305 | 3300010167 | Bacteria | 1843 |
| 88 | Ga0265387_1004456 | 3300024582 | Unclassified | 1907 |
| 89 | Ga0466692_099774 | 3300042591 | Bacteria | 51055 |
| 90 | Ga0466696_146362 | 3300042596 | Bacteria | 19783 |
| 91 | Ga0466706_161387 | 3300042599 | Bacteria | 1259 |
| 92 | Ga0466700_054460 | 3300042600 | Bacteria | 102434 |
| 93 | Ga0466700_432608 | 3300042600 | Bacteria | 3389 |
| 94 | Ga0466713_056293 | 3300042602 | Unclassified | 2204 |
| 95 | Ga0466722_094110 | 3300042609 | Unclassified | 2230 |
| 96 | Ga0466735_108202 | 3300042624 | Bacteria | 1308 |
| 97 | Ga0466730_081936 | 3300042625 | Bacteria | 13722 |
| 98 | Ga0466703_000995 | 3300042636 | Bacteria | 1114 |
| 99 | Ga0466704_618519 | 3300042643 | Unclassified | 4244 |
| 100 | Ga0466727_226768 | 3300042655 | Unclassified | 4397 |
| 101 | 2227494793 | 2225789004 | Unclassified | 770 |
| 102 | 2227655748 | 2225789004 | Unclassified | 1975 |
| 103 | IMNBL1DRAFT_c0089545 | 3300000062 | Bacteria | 846 |
| 104 | JGI24702J35022_10002643 | 3300002462 | Bacteria | 10873 |
| 105 | Ga0104050_1027128 | 3300007153 | Unclassified | 2166 |
| 106 | Ga0466705_025497 | 3300042612 | Bacteria | 5436 |
| 107 | Ga0466705_029661 | 3300042612 | Bacteria | 15539 |
| 108 | Ga0466705_120594 | 3300042612 | Unclassified | 3375 |
| 109 | Ga0466733_001902 | 3300042659 | Bacteria | 4103 |
| 110 | Ga0466705_391819 | 3300042612 | Unclassified | 7382 |
| 111 | Ga0466711_294542 | 3300042615 | Bacteria | 4323 |
| 112 | Ga0466715_084076 | 3300042616 | Bacteria | 2197 |
| 113 | Ga0466726_011831 | 3300042619 | Bacteria | 1125 |
| 114 | Ga0466726_300078 | 3300042619 | Bacteria | 1905 |
| 115 | Ga0466728_013139 | 3300042620 | Bacteria | 55903 |
| 116 | Ga0123355_10569218 | 3300009826 | Bacteria | 1360 |
| 117 | Ga0123356_10000008 | 3300010049 | Bacteria | 237851 |
| 118 | Ga0123356_10955449 | 3300010049 | Bacteria | 1028 |
| 119 | Ga0466657_175359 | 3300042582 | Unclassified | 4835 |
| 120 | Ga0466693_234931 | 3300042592 | Bacteria | 1849 |
| 121 | Ga0466694_024004 | 3300042594 | Bacteria | 1507 |
| 122 | Ga0466694_041363 | 3300042594 | Unclassified | 1691 |
| 123 | Ga0466696_500331 | 3300042596 | Bacteria | 32699 |
| 124 | Ga0466706_055797 | 3300042599 | Bacteria | 1900 |
| 125 | Ga0466706_270253 | 3300042599 | Unclassified | 12357 |
| 126 | Ga0466707_193890 | 3300042601 | Unclassified | 9661 |
| 127 | Ga0466722_022507 | 3300042609 | Bacteria | 12182 |
| 128 | Ga0466735_018201 | 3300042624 | Bacteria | 2936 |
| 129 | Ga0466735_140662 | 3300042624 | Unclassified | 1266 |
| 130 | Ga0466727_292162 | 3300042655 | Bacteria | 9466 |
| 131 | IMNBL1DRAFT_c0103979 | 3300000062 | Unclassified | 760 |
| 132 | JGI24696J40584_12943258 | 3300002834 | Unclassified | 1768 |
| 133 | JGI24696J40584_12960725 | 3300002834 | Bacteria | 8216 |
| 134 | Ga0068302_10108916 | 3300005071 | Bacteria | 4620 |
| 135 | Ga0466711_241851 | 3300042615 | Bacteria | 11602 |
| 136 | Ga0466728_024886 | 3300042620 | Bacteria | 15208 |
| 137 | Ga0466728_269940 | 3300042620 | Unclassified | 1877 |
| 138 | Ga0466728_424041 | 3300042620 | Bacteria | 46685 |
| 139 | Ga0123353_10005665 | 3300010167 | Unclassified | 16456 |
| 140 | Ga0123353_10848204 | 3300010167 | Bacteria | 1253 |
| 141 | Ga0466696_469682 | 3300042596 | Bacteria | 5194 |
| 142 | Ga0466699_363151 | 3300042597 | Unclassified | 2734 |
| 143 | Ga0466706_011321 | 3300042599 | Unclassified | 2570 |
| 144 | Ga0466706_147300 | 3300042599 | Bacteria | 13353 |
| 145 | Ga0466707_000955 | 3300042601 | Unclassified | 3125 |
| 146 | Ga0466713_114189 | 3300042602 | Bacteria | 34018 |
| 147 | Ga0466716_121228 | 3300042605 | Bacteria | 19334 |
| 148 | Ga0466719_005350 | 3300042606 | Bacteria | 6731 |
| 149 | Ga0466722_261677 | 3300042609 | Bacteria | 1516 |
| 150 | Ga0466703_098605 | 3300042636 | Bacteria | 6901 |
| 151 | 2227465131 | 2225789004 | Unclassified | 977 |
| 152 | IMNBL1DRAFT_c0068958 | 3300000062 | Unclassified | 1029 |
| 153 | JGI24702J35022_10096648 | 3300002462 | Bacteria | 1613 |
| 154 | Ga0068302_10129381 | 3300005071 | Unclassified | 2499 |
| 155 | Ga0068302_10430527 | 3300005071 | Unclassified | 1177 |
| 156 | Ga0466705_143850 | 3300042612 | Bacteria | 38978 |
| 157 | Ga0123353_12354959 | 3300010167 | Unclassified | 638 |
| 158 | Ga0466690_077926 | 3300042590 | Bacteria | 4747 |
| 159 | Ga0466690_172738 | 3300042590 | Bacteria | 57212 |
| 160 | Ga0466695_060817 | 3300042595 | Bacteria | 2223 |
| 161 | Ga0466696_489357 | 3300042596 | Bacteria | 8948 |
| 162 | Ga0466714_124714 | 3300042603 | Bacteria | 2264 |
| 163 | Ga0466716_279966 | 3300042605 | Bacteria | 1253 |
| 164 | Ga0466719_186573 | 3300042606 | Bacteria | 15608 |
| 165 | Ga0466729_199010 | 3300042621 | Bacteria | 1026 |
| 166 | Ga0466703_101237 | 3300042636 | Bacteria | 13083 |
| 167 | Ga0466703_165459 | 3300042636 | Bacteria | 12745 |
| 168 | Ga0466704_236040 | 3300042643 | Bacteria | 23395 |
| 169 | Ga0466709_228700 | 3300042648 | Bacteria | 33858 |
| 170 | Ga0466708_178031 | 3300042652 | Unclassified | 10566 |
| 171 | IMNBL1DRAFT_c0004514 | 3300000062 | Bacteria | 8321 |
| 172 | IMNBL1DRAFT_c0052502 | 3300000062 | Unclassified | 1276 |
| 173 | JGI24695J34938_10153337 | 3300002450 | Bacteria | 945 |
| 174 | JGI24702J35022_10001240 | 3300002462 | Bacteria | 15911 |
| 175 | JGI24702J35022_10279250 | 3300002462 | Bacteria | 980 |
| 176 | JGI24702J35022_10963744 | 3300002462 | Bacteria | 531 |
| 177 | Ga0068305_10008809 | 3300005083 | Bacteria | 7136 |
| 178 | Ga0074310_1131426 | 3300005308 | Bacteria | 734 |
| 179 | Ga0466697_210414 | 3300042611 | Bacteria | 3861 |
| 180 | Ga0466715_043219 | 3300042616 | Bacteria | 25123 |
| 181 | Ga0466718_120578 | 3300042617 | Unclassified | 1223 |
| 182 | Ga0123353_10153795 | 3300010167 | Bacteria | 3670 |
| 183 | Ga0415639_053742 | 3300038395 | Unclassified | 13761 |
| 184 | Ga0466657_337380 | 3300042582 | Bacteria | 20451 |
| 185 | Ga0466692_028583 | 3300042591 | Bacteria | 7688 |
| 186 | Ga0466693_063216 | 3300042592 | Unclassified | 2473 |
| 187 | Ga0466691_101613 | 3300042593 | Bacteria | 14009 |
| 188 | Ga0466696_431360 | 3300042596 | Bacteria | 2943 |
| 189 | Ga0466707_034475 | 3300042601 | Bacteria | 4944 |
| 190 | Ga0466707_311653 | 3300042601 | Bacteria | 12538 |
| 191 | Ga0466713_135641 | 3300042602 | Bacteria | 4462 |
| 192 | Ga0466716_434229 | 3300042605 | Bacteria | 25603 |
| 193 | Ga0466722_140882 | 3300042609 | Bacteria | 9482 |
| 194 | Ga0466697_043789 | 3300042611 | Bacteria | 1059 |
| 195 | Ga0466734_102043 | 3300042623 | Unclassified | 1044 |
| 196 | Ga0466735_029856 | 3300042624 | Bacteria | 2154 |
| 197 | Ga0466703_282993 | 3300042636 | Unclassified | 1482 |
| 198 | Ga0466704_175541 | 3300042643 | Bacteria | 41528 |
| 199 | Ga0466709_096536 | 3300042648 | Bacteria | 31729 |
| 200 | Ga0466709_180094 | 3300042648 | Bacteria | 3705 |
| 201 | IMNBGM34_c014113 | 3300000036 | Bacteria | 996 |
| 202 | IMNBL1DRAFT_c0125693 | 3300000062 | Bacteria | 671 |
| 203 | IMNBL1DRAFT_c0154343 | 3300000062 | Unclassified | 588 |
| 204 | JGI24702J35022_10080140 | 3300002462 | Bacteria | 1768 |
| 205 | JGI24702J35022_10149600 | 3300002462 | Unclassified | 1309 |
| 206 | JGI24702J35022_10288249 | 3300002462 | Bacteria | 965 |
| 207 | Ga0068305_10161916 | 3300005083 | Unclassified | 2287 |
| 208 | Ga0068305_10748228 | 3300005083 | Bacteria | 696 |
| 209 | Ga0104019_1191615 | 3300007150 | Bacteria | 1771 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00468 | Ribosomal_L34 | Ribosomal protein L34 | 3 | 46 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.