Protein Family IF03077

Metagenome Isolate
472 Members
212 Samples
371 Scaffolds
572.43 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10024343|Ga0123353_100243436
Length
667 aa
Sequence
LHHFIEQPVNDDFCVFVKPSIIVNPKNPLANHQRFSPLTQNGIIRYNVGLVFLLSAMPKTSREKHQTNTETQSPALMMSGADILIQSLVNAGVDVIWSYPGGTVIPLHQAMTRFRDKLRVILPRQEQGGGFAAQGYARSTGKIGVCTATSGPGAANLITSIADAKLDSIPLLAITGQVATPAIGSDAFQETPFTEMCRSVTKHHYLVTDVNNIARIVREAIHIATTGRPGPVLIDVPRNIQVAQCIPDFNAEMDLPGYDDEFPEPSDDVLEQIAEDIRKAKNPILYVGGGIIASDSSAELRKLAELTQIPVTTTMMALSAFPREHKLSLGMPGMHGTAYANHAIHDCDLLLAFGVRFDDRVTGKASEFAKHAKIIHVDIDSSEINKVKQADIAVVCNVKDVLQGLLKKLGKYKPSPELERWHQKIDQWKHEMPMDFGTTCGKFSATDVESPHITAQYAIHELWKATHNRDAIIVTGVGQHQMWTAQFYRFSKPRTWLSSAGLGTMGFGLPAAIGAKVAHPDKLVIDIDGDGSFQMNIQEMATCHCEKIPMKVMLLNNQHLGMVMQWEDRFFQSNRAHTYLGPIDHPETLGKGTGIGPETRYPDFVAIAKGFGWEAMLVSEKSELPAAIEKMIDHPGSFLLDVTIPYQEHVLPMIPAGATVLEMIRR*

📊 Sample Types

Isolate 21.2%
Metagenome 78.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 33.5%
Termitidae 17.0%
Formicidae 9.3%
Kalotermitidae 7.7%
Culicidae 5.7%
Armadillidiidae 4.6%
Tenebrionidae 3.6%
Elmidae 3.1%
Scarabaeidae 2.6%
Blattidae 2.1%
Rhinotermitidae 2.1%
Termopsidae 2.1%
Passalidae 1.5%
Drosophilidae 1.0%
Aphrophoridae 0.5%
Daphniidae 0.5%
Thomisidae 0.5%
Hodotermitidae 0.5%
Bombycidae 0.5%
Kiwaidae 0.5%
Pseudophyllodromiidae 0.5%
Aphididae 0.5%

🌳 Taxonomy

Archaea 12
Bacteria 440
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820836992 Unclassified Actinobacteria Lab288P4bin32 Isolate Unclassified
2 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
3 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
4 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
5 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
6 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
7 2510917001 Candidatus Sulcia muelleri PSPU Isolate Aphrophoridae
8 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
9 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
10 2773857680 Unclassified Methanomassiliicoccaceae Emb289P3bin41 Isolate Unclassified
11 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
12 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
13 2820641689 Unclassified Firmicutes Cu122P5bin5 Isolate Unclassified
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
16 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
17 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
18 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
21 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
22 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
23 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
24 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
25 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
28 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
29 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
30 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
31 2882250448 Bizionia sp. APA-3 Isolate
32 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
33 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
34 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
35 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
36 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
37 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
38 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
39 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
40 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
41 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
42 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
43 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
44 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
45 648028014 Candidatus Sulcia muelleri CARI Isolate Unclassified
46 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
47 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
48 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
49 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
50 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
51 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
52 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
53 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
54 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
55 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
56 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
57 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
58 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
59 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
60 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
61 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
62 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
63 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
64 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
65 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
66 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
67 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
68 2896350215 Sphingobacterium sp. xlx-183 Isolate
69 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
70 2687453757 Opitutus sp. Cag34 Isolate Unclassified
71 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
72 2773857677 Methanoplasma sp. Cu122P5bin30 Isolate Unclassified
73 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
74 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
75 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
76 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
77 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
78 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
79 2820196379 Unclassified Planctomycetes Emb289P3bin158 Isolate Unclassified
80 2820733257 Unclassified Chloroflexi Lab288P4bin59 Isolate Unclassified
81 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
82 3002678670 Agromyces sp. G127AT Isolate Unclassified
83 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
84 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
85 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
86 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
87 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
88 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
89 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
90 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
91 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
92 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
93 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
94 2898741527 Sphingobacterium sp. xlx-73 Isolate
95 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
96 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
97 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
98 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
99 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
100 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
101 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
102 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
103 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
104 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
105 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
106 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
107 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
108 3300006995 Ant gut microbial communities from Cephalotes angustus, Brazil Metagenome Formicidae
109 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
110 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
111 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
112 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
113 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
114 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
115 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
116 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
117 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
118 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
119 2896321640 Sphingobacterium sp. xlx-130 Isolate
120 2931425734 Nocardioides sp. J2M5 Isolate
121 2931430189 Tessaracoccus palaemonis J1M15 Isolate
122 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
123 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
124 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
125 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
126 2820007728 Unclassified Synergistetes Lab288P3bin114 Isolate Unclassified
127 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
128 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
129 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
130 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
131 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
132 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
133 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
134 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
135 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
136 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
137 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
138 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
139 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
140 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
141 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
142 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
143 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
144 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
145 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
146 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
147 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
148 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
149 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
150 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
151 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
152 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
153 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
154 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
155 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
156 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
157 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
158 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
159 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
160 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
161 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
162 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
163 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
164 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
165 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
166 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
167 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
168 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
169 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
170 2773857688 Unclassified Methanomassiliicoccaceae Nt197P3bin45 Isolate Unclassified
171 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
172 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
173 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
174 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
175 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
176 2603880164 Opitutus sp. Isolate Formicidae
177 2820137450 Unclassified Proteobacteria Emb289P3bin120 Isolate Unclassified
178 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
179 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
180 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
181 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
182 3002029927 Blattabacterium cuenoti CHORISOsp Isolate Pseudophyllodromiidae
183 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
184 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
185 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
186 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
187 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
188 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
189 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
190 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
191 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
192 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
193 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
194 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
195 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
196 2820931684 Unclassified Actinobacteria Emb289P1bin89 Isolate Unclassified
197 2896330536 Sphingobacterium sp. xlx-96 Isolate
198 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
199 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
200 2773857697 Unclassified Methanomassiliicoccaceae Th196P4bin34 Isolate Unclassified
201 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
202 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
203 2998929858 Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 Isolate Aphididae
204 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
205 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
206 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
207 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
208 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
209 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
210 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
211 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
212 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_205810 3300042612 Bacteria 60547
2 Ga0123356_10037628 3300010049 Bacteria 4513
3 Ga0123356_10047381 3300010049 Bacteria 4000
4 Ga0123353_10000170 3300010167 Bacteria 82296
5 Ga0123353_10024343 3300010167 Bacteria 9189
6 Ga0466711_045149 3300042615 Bacteria 15753
7 Ga0466711_239916 3300042615 Bacteria 5746
8 Ga0466715_083240 3300042616 Bacteria 8564
9 Ga0466715_302876 3300042616 Bacteria 31216
10 Ga0466715_345723 3300042616 Bacteria 5407
11 Ga0466715_485848 3300042616 Bacteria 6382
12 Ga0466718_049318 3300042617 Bacteria 63032
13 Ga0466729_166636 3300042621 Bacteria 1935
14 Ga0466729_289568 3300042621 Bacteria 8241
15 Ga0466731_119536 3300042622 Bacteria 6554
16 Ga0466734_083099 3300042623 Archaea 42182
17 Ga0466730_054806 3300042625 Bacteria 801523
18 Ga0466709_053158 3300042648 Bacteria 3597
19 Ga0466724_22014 3300042649 Bacteria 158058
20 Ga0466708_102293 3300042652 Bacteria 30401
21 Ga0160455_100990 3300012837 Unclassified 10263
22 Ga0160460_101647 3300012845 Bacteria 6861
23 Ga0160448_103398 3300012854 Bacteria 4672
24 Ga0160436_1000942 3300012861 Bacteria 8858
25 Ga0415639_048593 3300038395 Bacteria 7917
26 Ga0466692_076702 3300042591 Bacteria 28626
27 Ga0466692_203370 3300042591 Bacteria 17661
28 Ga0466694_019092 3300042594 Bacteria 7763
29 Ga0466706_141330 3300042599 Bacteria 30346
30 Ga0466706_177431 3300042599 Bacteria 7418
31 Ga0466713_048951 3300042602 Bacteria 3485
32 Ga0466713_090088 3300042602 Bacteria 4949
33 Ga0466713_107330 3300042602 Bacteria 4950
34 Ga0466719_075479 3300042606 Bacteria 2539
35 Ga0466719_144344 3300042606 Bacteria 5662
36 JGI24695J34938_10000343 3300002450 Bacteria 45746
37 Ga0104048_1168692 3300007143 Bacteria 3121
38 Ga0103267_1000232 3300007190 Bacteria 26322
39 Ga0466697_181375 3300042611 Bacteria 3284
40 Ga0466705_118311 3300042612 Bacteria 3731
41 Ga0466705_128592 3300042612 Bacteria 3992
42 Ga0466705_168660 3300042612 Bacteria 101305
43 Ga0466705_385246 3300042612 Bacteria 20984
44 Ga0123355_10051660 3300009826 Bacteria 6670
45 Ga0123356_10003304 3300010049 Bacteria 16938
46 Ga0123356_10019715 3300010049 Bacteria 6391
47 Ga0123356_10036312 3300010049 Bacteria 4603
48 Ga0123353_10068738 3300010167 Bacteria 5689
49 Ga0123353_10122886 3300010167 Bacteria 4173
50 Ga0123353_10128321 3300010167 Bacteria 4072
51 Ga0123354_10042200 3300010882 Bacteria 7036
52 Ga0123354_10044998 3300010882 Bacteria 6761
53 Ga0123354_10140068 3300010882 Archaea 2998
54 Ga0466712_034590 3300042614 Bacteria 2744
55 Ga0466723_069274 3300042618 Bacteria 5691
56 Ga0466723_137319 3300042618 Bacteria 34367
57 Ga0466723_251514 3300042618 Bacteria 3660
58 Ga0466729_141427 3300042621 Bacteria 6498
59 Ga0466729_196745 3300042621 Bacteria 21071
60 Ga0466703_081658 3300042636 Bacteria 26167
61 Ga0466703_100612 3300042636 Bacteria 66039
62 Ga0466704_173941 3300042643 Bacteria 14798
63 Ga0466704_305519 3300042643 Archaea 1856
64 Ga0466709_046875 3300042648 Bacteria 5608
65 Ga0466724_25732 3300042649 Bacteria 52198
66 Ga0466708_305430 3300042652 Bacteria 9932
67 Ga0466725_252676 3300042654 Bacteria 2017
68 Ga0466725_375722 3300042654 Bacteria 2035
69 Ga0466727_057740 3300042655 Bacteria 4952
70 Ga0160472_100115 3300012839 Bacteria 127421
71 Ga0160444_100090 3300012841 Bacteria 116868
72 Ga0160430_102614 3300012852 Bacteria 5569
73 Ga0157631_118613 3300013007 Bacteria 11644
74 Ga0415639_006492 3300038395 Bacteria 23076
75 Ga0466690_017021 3300042590 Bacteria 3363
76 Ga0466690_162583 3300042590 Bacteria 31228
77 Ga0466692_043174 3300042591 Bacteria 22907
78 Ga0466701_001389 3300042598 Bacteria 2409
79 Ga0466701_076781 3300042598 Archaea 4714
80 Ga0466700_452118 3300042600 Bacteria 32804
81 Ga0466707_350957 3300042601 Bacteria 12319
82 Ga0466713_075165 3300042602 Bacteria 11919
83 Ga0466717_030873 3300042604 Bacteria 2530
84 Ga0466717_165713 3300042604 Bacteria 2272
85 Ga0466719_125371 3300042606 Bacteria 4071
86 Ga0466719_522042 3300042606 Bacteria 3922
87 Ga0466720_097536 3300042607 Bacteria 8907
88 Ga0466722_088105 3300042609 Bacteria 10951
89 Ga0466722_132299 3300042609 Bacteria 91418
90 Ga0466722_260930 3300042609 Bacteria 5351
91 2227466310 2225789004 Bacteria 24399
92 IMNBL1DRAFT_c0016261 3300000062 Bacteria 3193
93 Meta3P_1002643 3300002464 Bacteria 29387
94 Ga0072941_1000016 3300005201 Bacteria 165423
95 Ga0102737_1000026 3300007142 Unclassified 42067
96 Ga0466733_082697 3300042659 Bacteria 8091
97 Ga0562379_0125 3300056790 Bacteria 239397
98 Ga0123356_10004461 3300010049 Bacteria 14469
99 Ga0123356_10005385 3300010049 Bacteria 13038
100 Ga0123356_10088599 3300010049 Unclassified 2943
101 Ga0123356_10204741 3300010049 Bacteria 2016
102 Ga0123353_10000019 3300010167 Bacteria 185006
103 Ga0123353_10046154 3300010167 Bacteria 6919
104 Ga0123353_10069659 3300010167 Bacteria 5650
105 Ga0123353_10181626 3300010167 Bacteria 3330
106 Ga0466705_397101 3300042612 Bacteria 24789
107 Ga0466711_042770 3300042615 Bacteria 2959
108 Ga0466711_334169 3300042615 Bacteria 5146
109 Ga0466711_511514 3300042615 Bacteria 38268
110 Ga0466715_138633 3300042616 Bacteria 9372
111 Ga0466723_141507 3300042618 Bacteria 6112
112 Ga0466723_287759 3300042618 Bacteria 52406
113 Ga0466729_227373 3300042621 Unclassified 2344
114 Ga0466730_011760 3300042625 Bacteria 327787
115 Ga0466703_337715 3300042636 Bacteria 2135
116 Ga0466704_256111 3300042643 Bacteria 159283
117 Ga0466724_04368 3300042649 Unclassified 4313
118 Ga0466708_048002 3300042652 Bacteria 4133
119 Ga0466725_218436 3300042654 Bacteria 2942
120 Ga0466727_149972 3300042655 Bacteria 8441
121 Ga0160469_102064 3300012824 Bacteria 4205
122 Ga0160441_100594 3300012825 Bacteria 23225
123 Ga0160459_100664 3300012831 Bacteria 12004
124 Ga0160433_100420 3300012846 Bacteria 22641
125 Ga0160457_1000009 3300012858 Bacteria 506736
126 Ga0265387_1000749 3300024582 Bacteria 4979
127 Ga0466694_006347 3300042594 Bacteria 12968
128 Ga0466694_327094 3300042594 Bacteria 4515
129 Ga0466695_358698 3300042595 Bacteria 69758
130 Ga0466699_146309 3300042597 Bacteria 10230
131 Ga0466701_102190 3300042598 Bacteria 20013
132 Ga0466706_077133 3300042599 Bacteria 15518
133 Ga0466706_257047 3300042599 Bacteria 5831
134 Ga0466700_457508 3300042600 Bacteria 4681
135 Ga0466714_124343 3300042603 Bacteria 29085
136 Ga0466716_053160 3300042605 Unclassified 7046
137 Ga0466698_502308 3300042610 Bacteria 2732
138 JGI24695J34938_10031752 3300002450 Bacteria 2446
139 Ga0068305_10066994 3300005083 Bacteria 10185
140 Ga0102733_100004 3300006995 Bacteria 97031
141 Ga0102734_1000084 3300007129 Bacteria 29145
142 Ga0102734_1000373 3300007129 Bacteria 42767
143 Ga0123357_10000026 3300009784 Bacteria 128045
144 Ga0466705_005716 3300042612 Bacteria 4717
145 Ga0123355_10072821 3300009826 Bacteria 5509
146 Ga0123355_10170856 3300009826 Bacteria 3250
147 Ga0123356_10000351 3300010049 Bacteria 52507
148 Ga0123356_10002065 3300010049 Bacteria 21651
149 Ga0123356_10004177 3300010049 Bacteria 14977
150 Ga0123356_10008395 3300010049 Bacteria 10269
151 Ga0123356_10119852 3300010049 Bacteria 2557
152 Ga0123353_10003646 3300010167 Bacteria 19520
153 Ga0123353_10005903 3300010167 Bacteria 16192
154 Ga0466705_437717 3300042612 Bacteria 40567
155 Ga0466710_011851 3300042613 Bacteria 4534
156 Ga0466711_137983 3300042615 Bacteria 7284
157 Ga0466711_184519 3300042615 Bacteria 28551
158 Ga0466723_045042 3300042618 Bacteria 5201
159 Ga0466723_132916 3300042618 Bacteria 42296
160 Ga0466703_393877 3300042636 Bacteria 98275
161 Ga0466704_294025 3300042643 Bacteria 7152
162 Ga0466709_199853 3300042648 Bacteria 2812
163 Ga0160431_104770 3300012828 Bacteria 2405
164 Ga0160433_100368 3300012846 Bacteria 26229
165 Ga0160445_100280 3300012847 Bacteria 33950
166 Ga0160443_100327 3300012848 Bacteria 44155
167 Ga0466692_169156 3300042591 Bacteria 59346
168 Ga0466694_175619 3300042594 Bacteria 2665
169 Ga0466696_004159 3300042596 Bacteria 9316
170 Ga0466706_028908 3300042599 Bacteria 27379
171 Ga0466706_138301 3300042599 Bacteria 29290
172 Ga0466706_156906 3300042599 Bacteria 4906
173 Ga0466700_137486 3300042600 Bacteria 5854
174 Ga0466719_306626 3300042606 Bacteria 7564
175 IMNBL1DRAFT_c0000088 3300000062 Bacteria 80215
176 CVPL010W_10002748 3300002931 Bacteria 24536
177 Ga0072941_1226800 3300005201 Bacteria 7719
178 Ga0102736_1000106 3300007052 Bacteria 26068
179 Ga0102735_1000030 3300007080 Bacteria 73717
180 Ga0102740_1000220 3300007140 Bacteria 16312
181 Ga0103268_1001540 3300007192 Unclassified 10722
182 Ga0466705_296838 3300042612 Bacteria 15201
183 Ga0466733_166692 3300042659 Bacteria 9523
184 Ga0562378_0355 3300056814 Bacteria 89245
185 Ga0562377_0071 3300056842 Bacteria 439264
186 Ga0562375_5239 3300056856 Bacteria 8246
187 Ga0123356_10000857 3300010049 Unclassified 33875
188 Ga0123356_10002217 3300010049 Bacteria 20923
189 Ga0123356_10042576 3300010049 Bacteria 4230
190 Ga0123353_10044345 3300010167 Bacteria 7050
191 Ga0123353_10064987 3300010167 Unclassified 5857
192 Ga0123353_10091438 3300010167 Bacteria 4902
193 Ga0160464_100594 3300012805 Bacteria 23577
194 Ga0160466_103808 3300012809 Bacteria 2339
195 Ga0466715_033684 3300042616 Bacteria 15295
196 Ga0466723_038935 3300042618 Bacteria 2211
197 Ga0466723_353883 3300042618 Bacteria 2535
198 Ga0466728_320717 3300042620 Bacteria 40765
199 Ga0466729_173068 3300042621 Archaea 2519
200 Ga0466735_115119 3300042624 Bacteria 11278
201 Ga0466735_156955 3300042624 Bacteria 5972
202 Ga0466704_288212 3300042643 Bacteria 11956
203 Ga0466704_350877 3300042643 Bacteria 6942
204 Ga0466724_66581 3300042649 Bacteria 665985
205 Ga0466708_231841 3300042652 Bacteria 67849
206 Ga0466708_240824 3300042652 Bacteria 7216
207 Ga0466708_265321 3300042652 Bacteria 14189
208 Ga0466708_416110 3300042652 Bacteria 70714
209 Ga0466708_453937 3300042652 Bacteria 13560
210 Ga0466727_033664 3300042655 Bacteria 4729
211 Ga0466727_335509 3300042655 Bacteria 1995
212 Ga0160467_100220 3300012829 Bacteria 73452
213 Ga0160457_1001346 3300012858 Bacteria 6961
214 Ga0415639_028590 3300038395 Bacteria 5178
215 Ga0415639_177472 3300038395 Bacteria 2309
216 Ga0466699_153989 3300042597 Bacteria 13711
217 Ga0466701_076067 3300042598 Bacteria 52733
218 Ga0466701_079356 3300042598 Bacteria 4121
219 Ga0466706_060587 3300042599 Bacteria 19790
220 Ga0466707_343250 3300042601 Bacteria 2671
221 Ga0466713_015872 3300042602 Bacteria 9979
222 Ga0466713_115569 3300042602 Bacteria 9264
223 Ga0466722_051638 3300042609 Bacteria 15472
224 JGI24699J35502_11072256 3300002509 Bacteria 1860
225 Ga0068302_10036884 3300005071 Unclassified 2842
226 Ga0102736_1000057 3300007052 Bacteria 31963
227 Ga0103266_1000044 3300007067 Bacteria 89495
228 Ga0103260_1000014 3300007139 Bacteria 144579
229 Ga0102738_1000007 3300007141 Bacteria 181972
230 Ga0123357_10000615 3300009784 Bacteria 35314
231 Ga0466705_042717 3300042612 Bacteria 21329
232 Ga0123356_10000767 3300010049 Bacteria 35460
233 Ga0123356_10003716 3300010049 Bacteria 15903
234 Ga0123356_10003864 3300010049 Bacteria 15608
235 Ga0123356_10045660 3300010049 Bacteria 4076
236 Ga0123353_10001968 3300010167 Bacteria 25332
237 Ga0123353_10005272 3300010167 Bacteria 16908
238 Ga0123353_10019895 3300010167 Bacteria 9999
239 Ga0123353_10036222 3300010167 Bacteria 7728
240 Ga0123353_10368508 3300010167 Bacteria 2155
241 Ga0123354_10093659 3300010882 Bacteria 4128
242 Ga0160465_100152 3300012803 Bacteria 60106
243 Ga0466705_498368 3300042612 Bacteria 11688
244 Ga0466711_051710 3300042615 Bacteria 25077
245 Ga0466715_059738 3300042616 Bacteria 13741
246 Ga0466715_079488 3300042616 Bacteria 17871
247 Ga0466715_170777 3300042616 Bacteria 2928
248 Ga0466723_011755 3300042618 Bacteria 6044
249 Ga0466723_012899 3300042618 Bacteria 3016
250 Ga0466728_454134 3300042620 Bacteria 12943
251 Ga0466729_043233 3300042621 Bacteria 2620
252 Ga0466735_057798 3300042624 Bacteria 6194
253 Ga0466735_081139 3300042624 Bacteria 4699
254 Ga0466735_164792 3300042624 Bacteria 4036
255 Ga0466703_313034 3300042636 Bacteria 8491
256 Ga0466704_344496 3300042643 Bacteria 4954
257 Ga0466704_395985 3300042643 Bacteria 4741
258 Ga0466704_508228 3300042643 Bacteria 66197
259 Ga0466709_288828 3300042648 Bacteria 18400
260 Ga0466709_308129 3300042648 Bacteria 2835
261 Ga0466724_08127 3300042649 Bacteria 26680
262 Ga0466724_30060 3300042649 Unclassified 4314
263 Ga0466724_46140 3300042649 Bacteria 630192
264 Ga0160432_102495 3300012818 Bacteria 3847
265 Ga0160431_104803 3300012828 Bacteria 2388
266 Ga0160458_100263 3300012832 Unclassified 33700
267 Ga0160433_100053 3300012846 Bacteria 130466
268 Ga0160430_101833 3300012852 Bacteria 7368
269 Ga0466691_110498 3300042593 Bacteria 6244
270 Ga0466696_005003 3300042596 Bacteria 5482
271 Ga0466696_023490 3300042596 Bacteria 3141
272 Ga0466696_217649 3300042596 Bacteria 2244
273 Ga0466701_010990 3300042598 Bacteria 332169
274 Ga0466701_035380 3300042598 Bacteria 6995
275 Ga0466706_030493 3300042599 Bacteria 13577
276 Ga0466706_228217 3300042599 Bacteria 67941
277 Ga0466707_168226 3300042601 Bacteria 11522
278 Ga0466713_001026 3300042602 Bacteria 36059
279 Ga0466714_055030 3300042603 Bacteria 6787
280 2227430793 2225789004 Bacteria 5571
281 IMNBGM34_c000044 3300000036 Bacteria 34860
282 JGI24695J34938_10001251 3300002450 Bacteria 22330
283 CVPL010W_10000615 3300002931 Unclassified 52736
284 Ga0072941_1147642 3300005201 Unclassified 3689
285 Ga0102737_1001419 3300007142 Unclassified 6687
286 Ga0103264_1015614 3300007188 Bacteria 3722
287 Ga0466705_151059 3300042612 Bacteria 39890
288 Ga0466705_343921 3300042612 Bacteria 17979
289 Ga0123356_10000425 3300010049 Bacteria 48140
290 Ga0123356_10000676 3300010049 Bacteria 37752
291 Ga0123356_10019663 3300010049 Bacteria 6400
292 Ga0123356_10030487 3300010049 Bacteria 5048
293 Ga0123356_10040931 3300010049 Bacteria 4317
294 Ga0123353_10181181 3300010167 Bacteria 3335
295 Ga0160454_100001 3300012798 Bacteria 780029
296 Ga0466715_001157 3300042616 Bacteria 44509
297 Ga0466715_314467 3300042616 Bacteria 26093
298 Ga0466715_321177 3300042616 Bacteria 8081
299 Ga0466715_350435 3300042616 Unclassified 1872
300 Ga0466726_200393 3300042619 Bacteria 4630
301 Ga0466726_271206 3300042619 Bacteria 3999
302 Ga0466726_345058 3300042619 Bacteria 18048
303 Ga0466703_392640 3300042636 Bacteria 16164
304 Ga0466704_453215 3300042643 Bacteria 5840
305 Ga0466724_11157 3300042649 Archaea 1968
306 Ga0466727_261820 3300042655 Bacteria 15247
307 Ga0160441_100409 3300012825 Bacteria 35491
308 Ga0466692_158668 3300042591 Bacteria 509148
309 Ga0466691_063579 3300042593 Bacteria 12437
310 Ga0466691_074227 3300042593 Bacteria 2281
311 Ga0466694_034645 3300042594 Bacteria 15920
312 Ga0466707_277610 3300042601 Bacteria 10435
313 Ga0466713_040722 3300042602 Bacteria 16258
314 Ga0466713_079531 3300042602 Bacteria 32951
315 Ga0466714_153426 3300042603 Bacteria 5784
316 Ga0466722_168692 3300042609 Bacteria 15443
317 JGI24696J40584_12961142 3300002834 Archaea 11149
318 Ga0072941_1035574 3300005201 Bacteria 9949
319 Ga0103265_1000010 3300007068 Bacteria 47599
320 Ga0103261_1000031 3300007083 Bacteria 447718
321 Ga0102739_1000414 3300007095 Unclassified 25069
322 Ga0104050_1005409 3300007153 Unclassified 10548
323 Ga0466697_072335 3300042611 Bacteria 13627
324 Ga0466705_336039 3300042612 Bacteria 4742
325 Ga0562376_0018 3300056857 Bacteria 481690
326 Ga0562374_0013 3300057007 Bacteria 1517757
327 Ga0123356_10000473 3300010049 Bacteria 45077
328 Ga0123356_10004719 3300010049 Bacteria 14042
329 Ga0123356_10008333 3300010049 Bacteria 10310
330 Ga0123356_10046959 3300010049 Bacteria 4018
331 Ga0123356_10093482 3300010049 Bacteria 2870
332 Ga0123353_10001983 3300010167 Bacteria 25286
333 Ga0123353_10006872 3300010167 Bacteria 15276
334 Ga0123353_10007831 3300010167 Bacteria 14507
335 Ga0123353_10057794 3300010167 Bacteria 6214
336 Ga0123354_10019215 3300010882 Bacteria 10726
337 Ga0466705_481155 3300042612 Bacteria 3792
338 Ga0466715_237416 3300042616 Bacteria 16444
339 Ga0466723_004854 3300042618 Bacteria 12577
340 Ga0466723_022972 3300042618 Bacteria 101765
341 Ga0466723_213455 3300042618 Bacteria 6776
342 Ga0466723_348373 3300042618 Bacteria 7676
343 Ga0466726_098184 3300042619 Bacteria 19922
344 Ga0466728_373369 3300042620 Archaea 2248
345 Ga0466731_113174 3300042622 Bacteria 1863
346 Ga0466735_087349 3300042624 Bacteria 5417
347 Ga0466703_217671 3300042636 Bacteria 6856
348 Ga0466704_258016 3300042643 Bacteria 2990
349 Ga0466708_312416 3300042652 Bacteria 85118
350 Ga0466727_155884 3300042655 Bacteria 6773
351 Ga0160468_100137 3300012819 Bacteria 69665
352 Ga0160467_101583 3300012829 Unclassified 8107
353 Ga0466657_062863 3300042582 Bacteria 5178
354 Ga0466690_109494 3300042590 Bacteria 8516
355 Ga0466692_045732 3300042591 Bacteria 10384
356 Ga0466692_161938 3300042591 Bacteria 121742
357 Ga0466691_042808 3300042593 Bacteria 14280
358 Ga0466706_014225 3300042599 Bacteria 6235
359 Ga0466706_161207 3300042599 Bacteria 22327
360 Ga0466706_164315 3300042599 Bacteria 60572
361 Ga0466713_050983 3300042602 Bacteria 10911
362 Ga0466714_008590 3300042603 Unclassified 2309
363 Ga0466698_005253 3300042610 Bacteria 2085
364 IMNBL1DRAFT_c0000879 3300000062 Bacteria 23426
365 IMNBL1DRAFT_c0019906 3300000062 Bacteria 2733
366 AustNasuHG_c1003867 3300000089 Bacteria 5394
367 JGI24703J35330_11747896 3300002501 Bacteria 8938
368 Ga0103263_100075 3300007042 Bacteria 55291
369 Ga0103264_1000101 3300007188 Bacteria 49856
370 Ga0103267_1000427 3300007190 Bacteria 14622
371 Ga0127649_100531 3300009460 Bacteria 18197

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 270 405 0.98
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 476 642 0.96
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 78 191 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02776 GO:0030976 thiamine pyrophosphate binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.