Protein Family IF03077
Metagenome
Isolate
472
Members
212
Samples
371
Scaffolds
572.43
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10024343|Ga0123353_100243436
- Length
- 667 aa
- Sequence
- LHHFIEQPVNDDFCVFVKPSIIVNPKNPLANHQRFSPLTQNGIIRYNVGLVFLLSAMPKTSREKHQTNTETQSPALMMSGADILIQSLVNAGVDVIWSYPGGTVIPLHQAMTRFRDKLRVILPRQEQGGGFAAQGYARSTGKIGVCTATSGPGAANLITSIADAKLDSIPLLAITGQVATPAIGSDAFQETPFTEMCRSVTKHHYLVTDVNNIARIVREAIHIATTGRPGPVLIDVPRNIQVAQCIPDFNAEMDLPGYDDEFPEPSDDVLEQIAEDIRKAKNPILYVGGGIIASDSSAELRKLAELTQIPVTTTMMALSAFPREHKLSLGMPGMHGTAYANHAIHDCDLLLAFGVRFDDRVTGKASEFAKHAKIIHVDIDSSEINKVKQADIAVVCNVKDVLQGLLKKLGKYKPSPELERWHQKIDQWKHEMPMDFGTTCGKFSATDVESPHITAQYAIHELWKATHNRDAIIVTGVGQHQMWTAQFYRFSKPRTWLSSAGLGTMGFGLPAAIGAKVAHPDKLVIDIDGDGSFQMNIQEMATCHCEKIPMKVMLLNNQHLGMVMQWEDRFFQSNRAHTYLGPIDHPETLGKGTGIGPETRYPDFVAIAKGFGWEAMLVSEKSELPAAIEKMIDHPGSFLLDVTIPYQEHVLPMIPAGATVLEMIRR*
Sample Types
Isolate
21.2%
Metagenome
78.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.5%
Termitidae
17.0%
Formicidae
9.3%
Kalotermitidae
7.7%
Culicidae
5.7%
Armadillidiidae
4.6%
Tenebrionidae
3.6%
Elmidae
3.1%
Scarabaeidae
2.6%
Blattidae
2.1%
Rhinotermitidae
2.1%
Termopsidae
2.1%
Passalidae
1.5%
Drosophilidae
1.0%
Aphrophoridae
0.5%
Daphniidae
0.5%
Thomisidae
0.5%
Hodotermitidae
0.5%
Bombycidae
0.5%
Kiwaidae
0.5%
Pseudophyllodromiidae
0.5%
Aphididae
0.5%
Taxonomy
Archaea
12
Bacteria
440
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820836992 | Unclassified Actinobacteria Lab288P4bin32 | Isolate | Unclassified |
| 2 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 3 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 4 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 5 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 6 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 7 | 2510917001 | Candidatus Sulcia muelleri PSPU | Isolate | Aphrophoridae |
| 8 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 9 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 10 | 2773857680 | Unclassified Methanomassiliicoccaceae Emb289P3bin41 | Isolate | Unclassified |
| 11 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 12 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 13 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 17 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 18 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 28 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 29 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 30 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 31 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 32 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 33 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 34 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 35 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 36 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 37 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 38 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 39 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 43 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 44 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 45 | 648028014 | Candidatus Sulcia muelleri CARI | Isolate | Unclassified |
| 46 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 47 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 48 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 49 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 50 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 51 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 52 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 53 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 54 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 55 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 56 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 57 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 58 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 59 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 60 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 61 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 62 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 63 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 64 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 65 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 66 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 67 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 68 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 69 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 70 | 2687453757 | Opitutus sp. Cag34 | Isolate | Unclassified |
| 71 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 72 | 2773857677 | Methanoplasma sp. Cu122P5bin30 | Isolate | Unclassified |
| 73 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 74 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 75 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 76 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 77 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 78 | 2820180635 | Unclassified Planctomycetes Lab288P3bin24 | Isolate | Unclassified |
| 79 | 2820196379 | Unclassified Planctomycetes Emb289P3bin158 | Isolate | Unclassified |
| 80 | 2820733257 | Unclassified Chloroflexi Lab288P4bin59 | Isolate | Unclassified |
| 81 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 82 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 83 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 84 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 85 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 86 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 87 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 88 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 89 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 90 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 91 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 92 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 93 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 94 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 95 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 96 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 97 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 98 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 99 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 100 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 101 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 102 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 103 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 104 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 105 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 106 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 107 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 108 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 109 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 110 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 111 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 112 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 113 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 114 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 115 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 116 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 117 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 118 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 119 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 120 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 121 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 122 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 123 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 124 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 125 | 2820581541 | Unclassified Firmicutes Emb289P3bin127 | Isolate | Unclassified |
| 126 | 2820007728 | Unclassified Synergistetes Lab288P3bin114 | Isolate | Unclassified |
| 127 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 128 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 129 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 130 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 131 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 132 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 133 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 134 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 135 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 136 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 137 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 138 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 139 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 140 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 141 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 142 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 143 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 144 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 145 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 146 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 147 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 148 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 149 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 150 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 151 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 152 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 153 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 154 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 155 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 156 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 157 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 158 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 159 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 160 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 161 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 162 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 163 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 164 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 165 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 166 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 167 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 168 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 169 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 170 | 2773857688 | Unclassified Methanomassiliicoccaceae Nt197P3bin45 | Isolate | Unclassified |
| 171 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 172 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 173 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 174 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 175 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 176 | 2603880164 | Opitutus sp. | Isolate | Formicidae |
| 177 | 2820137450 | Unclassified Proteobacteria Emb289P3bin120 | Isolate | Unclassified |
| 178 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 179 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 180 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 181 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 182 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 183 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 184 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 185 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 186 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 187 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 188 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 189 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 190 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 191 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 192 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 193 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 194 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 195 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 196 | 2820931684 | Unclassified Actinobacteria Emb289P1bin89 | Isolate | Unclassified |
| 197 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 198 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 199 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 200 | 2773857697 | Unclassified Methanomassiliicoccaceae Th196P4bin34 | Isolate | Unclassified |
| 201 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 202 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 203 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 204 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 205 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 206 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 207 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 208 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 209 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 210 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 211 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 212 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_205810 | 3300042612 | Bacteria | 60547 |
| 2 | Ga0123356_10037628 | 3300010049 | Bacteria | 4513 |
| 3 | Ga0123356_10047381 | 3300010049 | Bacteria | 4000 |
| 4 | Ga0123353_10000170 | 3300010167 | Bacteria | 82296 |
| 5 | Ga0123353_10024343 | 3300010167 | Bacteria | 9189 |
| 6 | Ga0466711_045149 | 3300042615 | Bacteria | 15753 |
| 7 | Ga0466711_239916 | 3300042615 | Bacteria | 5746 |
| 8 | Ga0466715_083240 | 3300042616 | Bacteria | 8564 |
| 9 | Ga0466715_302876 | 3300042616 | Bacteria | 31216 |
| 10 | Ga0466715_345723 | 3300042616 | Bacteria | 5407 |
| 11 | Ga0466715_485848 | 3300042616 | Bacteria | 6382 |
| 12 | Ga0466718_049318 | 3300042617 | Bacteria | 63032 |
| 13 | Ga0466729_166636 | 3300042621 | Bacteria | 1935 |
| 14 | Ga0466729_289568 | 3300042621 | Bacteria | 8241 |
| 15 | Ga0466731_119536 | 3300042622 | Bacteria | 6554 |
| 16 | Ga0466734_083099 | 3300042623 | Archaea | 42182 |
| 17 | Ga0466730_054806 | 3300042625 | Bacteria | 801523 |
| 18 | Ga0466709_053158 | 3300042648 | Bacteria | 3597 |
| 19 | Ga0466724_22014 | 3300042649 | Bacteria | 158058 |
| 20 | Ga0466708_102293 | 3300042652 | Bacteria | 30401 |
| 21 | Ga0160455_100990 | 3300012837 | Unclassified | 10263 |
| 22 | Ga0160460_101647 | 3300012845 | Bacteria | 6861 |
| 23 | Ga0160448_103398 | 3300012854 | Bacteria | 4672 |
| 24 | Ga0160436_1000942 | 3300012861 | Bacteria | 8858 |
| 25 | Ga0415639_048593 | 3300038395 | Bacteria | 7917 |
| 26 | Ga0466692_076702 | 3300042591 | Bacteria | 28626 |
| 27 | Ga0466692_203370 | 3300042591 | Bacteria | 17661 |
| 28 | Ga0466694_019092 | 3300042594 | Bacteria | 7763 |
| 29 | Ga0466706_141330 | 3300042599 | Bacteria | 30346 |
| 30 | Ga0466706_177431 | 3300042599 | Bacteria | 7418 |
| 31 | Ga0466713_048951 | 3300042602 | Bacteria | 3485 |
| 32 | Ga0466713_090088 | 3300042602 | Bacteria | 4949 |
| 33 | Ga0466713_107330 | 3300042602 | Bacteria | 4950 |
| 34 | Ga0466719_075479 | 3300042606 | Bacteria | 2539 |
| 35 | Ga0466719_144344 | 3300042606 | Bacteria | 5662 |
| 36 | JGI24695J34938_10000343 | 3300002450 | Bacteria | 45746 |
| 37 | Ga0104048_1168692 | 3300007143 | Bacteria | 3121 |
| 38 | Ga0103267_1000232 | 3300007190 | Bacteria | 26322 |
| 39 | Ga0466697_181375 | 3300042611 | Bacteria | 3284 |
| 40 | Ga0466705_118311 | 3300042612 | Bacteria | 3731 |
| 41 | Ga0466705_128592 | 3300042612 | Bacteria | 3992 |
| 42 | Ga0466705_168660 | 3300042612 | Bacteria | 101305 |
| 43 | Ga0466705_385246 | 3300042612 | Bacteria | 20984 |
| 44 | Ga0123355_10051660 | 3300009826 | Bacteria | 6670 |
| 45 | Ga0123356_10003304 | 3300010049 | Bacteria | 16938 |
| 46 | Ga0123356_10019715 | 3300010049 | Bacteria | 6391 |
| 47 | Ga0123356_10036312 | 3300010049 | Bacteria | 4603 |
| 48 | Ga0123353_10068738 | 3300010167 | Bacteria | 5689 |
| 49 | Ga0123353_10122886 | 3300010167 | Bacteria | 4173 |
| 50 | Ga0123353_10128321 | 3300010167 | Bacteria | 4072 |
| 51 | Ga0123354_10042200 | 3300010882 | Bacteria | 7036 |
| 52 | Ga0123354_10044998 | 3300010882 | Bacteria | 6761 |
| 53 | Ga0123354_10140068 | 3300010882 | Archaea | 2998 |
| 54 | Ga0466712_034590 | 3300042614 | Bacteria | 2744 |
| 55 | Ga0466723_069274 | 3300042618 | Bacteria | 5691 |
| 56 | Ga0466723_137319 | 3300042618 | Bacteria | 34367 |
| 57 | Ga0466723_251514 | 3300042618 | Bacteria | 3660 |
| 58 | Ga0466729_141427 | 3300042621 | Bacteria | 6498 |
| 59 | Ga0466729_196745 | 3300042621 | Bacteria | 21071 |
| 60 | Ga0466703_081658 | 3300042636 | Bacteria | 26167 |
| 61 | Ga0466703_100612 | 3300042636 | Bacteria | 66039 |
| 62 | Ga0466704_173941 | 3300042643 | Bacteria | 14798 |
| 63 | Ga0466704_305519 | 3300042643 | Archaea | 1856 |
| 64 | Ga0466709_046875 | 3300042648 | Bacteria | 5608 |
| 65 | Ga0466724_25732 | 3300042649 | Bacteria | 52198 |
| 66 | Ga0466708_305430 | 3300042652 | Bacteria | 9932 |
| 67 | Ga0466725_252676 | 3300042654 | Bacteria | 2017 |
| 68 | Ga0466725_375722 | 3300042654 | Bacteria | 2035 |
| 69 | Ga0466727_057740 | 3300042655 | Bacteria | 4952 |
| 70 | Ga0160472_100115 | 3300012839 | Bacteria | 127421 |
| 71 | Ga0160444_100090 | 3300012841 | Bacteria | 116868 |
| 72 | Ga0160430_102614 | 3300012852 | Bacteria | 5569 |
| 73 | Ga0157631_118613 | 3300013007 | Bacteria | 11644 |
| 74 | Ga0415639_006492 | 3300038395 | Bacteria | 23076 |
| 75 | Ga0466690_017021 | 3300042590 | Bacteria | 3363 |
| 76 | Ga0466690_162583 | 3300042590 | Bacteria | 31228 |
| 77 | Ga0466692_043174 | 3300042591 | Bacteria | 22907 |
| 78 | Ga0466701_001389 | 3300042598 | Bacteria | 2409 |
| 79 | Ga0466701_076781 | 3300042598 | Archaea | 4714 |
| 80 | Ga0466700_452118 | 3300042600 | Bacteria | 32804 |
| 81 | Ga0466707_350957 | 3300042601 | Bacteria | 12319 |
| 82 | Ga0466713_075165 | 3300042602 | Bacteria | 11919 |
| 83 | Ga0466717_030873 | 3300042604 | Bacteria | 2530 |
| 84 | Ga0466717_165713 | 3300042604 | Bacteria | 2272 |
| 85 | Ga0466719_125371 | 3300042606 | Bacteria | 4071 |
| 86 | Ga0466719_522042 | 3300042606 | Bacteria | 3922 |
| 87 | Ga0466720_097536 | 3300042607 | Bacteria | 8907 |
| 88 | Ga0466722_088105 | 3300042609 | Bacteria | 10951 |
| 89 | Ga0466722_132299 | 3300042609 | Bacteria | 91418 |
| 90 | Ga0466722_260930 | 3300042609 | Bacteria | 5351 |
| 91 | 2227466310 | 2225789004 | Bacteria | 24399 |
| 92 | IMNBL1DRAFT_c0016261 | 3300000062 | Bacteria | 3193 |
| 93 | Meta3P_1002643 | 3300002464 | Bacteria | 29387 |
| 94 | Ga0072941_1000016 | 3300005201 | Bacteria | 165423 |
| 95 | Ga0102737_1000026 | 3300007142 | Unclassified | 42067 |
| 96 | Ga0466733_082697 | 3300042659 | Bacteria | 8091 |
| 97 | Ga0562379_0125 | 3300056790 | Bacteria | 239397 |
| 98 | Ga0123356_10004461 | 3300010049 | Bacteria | 14469 |
| 99 | Ga0123356_10005385 | 3300010049 | Bacteria | 13038 |
| 100 | Ga0123356_10088599 | 3300010049 | Unclassified | 2943 |
| 101 | Ga0123356_10204741 | 3300010049 | Bacteria | 2016 |
| 102 | Ga0123353_10000019 | 3300010167 | Bacteria | 185006 |
| 103 | Ga0123353_10046154 | 3300010167 | Bacteria | 6919 |
| 104 | Ga0123353_10069659 | 3300010167 | Bacteria | 5650 |
| 105 | Ga0123353_10181626 | 3300010167 | Bacteria | 3330 |
| 106 | Ga0466705_397101 | 3300042612 | Bacteria | 24789 |
| 107 | Ga0466711_042770 | 3300042615 | Bacteria | 2959 |
| 108 | Ga0466711_334169 | 3300042615 | Bacteria | 5146 |
| 109 | Ga0466711_511514 | 3300042615 | Bacteria | 38268 |
| 110 | Ga0466715_138633 | 3300042616 | Bacteria | 9372 |
| 111 | Ga0466723_141507 | 3300042618 | Bacteria | 6112 |
| 112 | Ga0466723_287759 | 3300042618 | Bacteria | 52406 |
| 113 | Ga0466729_227373 | 3300042621 | Unclassified | 2344 |
| 114 | Ga0466730_011760 | 3300042625 | Bacteria | 327787 |
| 115 | Ga0466703_337715 | 3300042636 | Bacteria | 2135 |
| 116 | Ga0466704_256111 | 3300042643 | Bacteria | 159283 |
| 117 | Ga0466724_04368 | 3300042649 | Unclassified | 4313 |
| 118 | Ga0466708_048002 | 3300042652 | Bacteria | 4133 |
| 119 | Ga0466725_218436 | 3300042654 | Bacteria | 2942 |
| 120 | Ga0466727_149972 | 3300042655 | Bacteria | 8441 |
| 121 | Ga0160469_102064 | 3300012824 | Bacteria | 4205 |
| 122 | Ga0160441_100594 | 3300012825 | Bacteria | 23225 |
| 123 | Ga0160459_100664 | 3300012831 | Bacteria | 12004 |
| 124 | Ga0160433_100420 | 3300012846 | Bacteria | 22641 |
| 125 | Ga0160457_1000009 | 3300012858 | Bacteria | 506736 |
| 126 | Ga0265387_1000749 | 3300024582 | Bacteria | 4979 |
| 127 | Ga0466694_006347 | 3300042594 | Bacteria | 12968 |
| 128 | Ga0466694_327094 | 3300042594 | Bacteria | 4515 |
| 129 | Ga0466695_358698 | 3300042595 | Bacteria | 69758 |
| 130 | Ga0466699_146309 | 3300042597 | Bacteria | 10230 |
| 131 | Ga0466701_102190 | 3300042598 | Bacteria | 20013 |
| 132 | Ga0466706_077133 | 3300042599 | Bacteria | 15518 |
| 133 | Ga0466706_257047 | 3300042599 | Bacteria | 5831 |
| 134 | Ga0466700_457508 | 3300042600 | Bacteria | 4681 |
| 135 | Ga0466714_124343 | 3300042603 | Bacteria | 29085 |
| 136 | Ga0466716_053160 | 3300042605 | Unclassified | 7046 |
| 137 | Ga0466698_502308 | 3300042610 | Bacteria | 2732 |
| 138 | JGI24695J34938_10031752 | 3300002450 | Bacteria | 2446 |
| 139 | Ga0068305_10066994 | 3300005083 | Bacteria | 10185 |
| 140 | Ga0102733_100004 | 3300006995 | Bacteria | 97031 |
| 141 | Ga0102734_1000084 | 3300007129 | Bacteria | 29145 |
| 142 | Ga0102734_1000373 | 3300007129 | Bacteria | 42767 |
| 143 | Ga0123357_10000026 | 3300009784 | Bacteria | 128045 |
| 144 | Ga0466705_005716 | 3300042612 | Bacteria | 4717 |
| 145 | Ga0123355_10072821 | 3300009826 | Bacteria | 5509 |
| 146 | Ga0123355_10170856 | 3300009826 | Bacteria | 3250 |
| 147 | Ga0123356_10000351 | 3300010049 | Bacteria | 52507 |
| 148 | Ga0123356_10002065 | 3300010049 | Bacteria | 21651 |
| 149 | Ga0123356_10004177 | 3300010049 | Bacteria | 14977 |
| 150 | Ga0123356_10008395 | 3300010049 | Bacteria | 10269 |
| 151 | Ga0123356_10119852 | 3300010049 | Bacteria | 2557 |
| 152 | Ga0123353_10003646 | 3300010167 | Bacteria | 19520 |
| 153 | Ga0123353_10005903 | 3300010167 | Bacteria | 16192 |
| 154 | Ga0466705_437717 | 3300042612 | Bacteria | 40567 |
| 155 | Ga0466710_011851 | 3300042613 | Bacteria | 4534 |
| 156 | Ga0466711_137983 | 3300042615 | Bacteria | 7284 |
| 157 | Ga0466711_184519 | 3300042615 | Bacteria | 28551 |
| 158 | Ga0466723_045042 | 3300042618 | Bacteria | 5201 |
| 159 | Ga0466723_132916 | 3300042618 | Bacteria | 42296 |
| 160 | Ga0466703_393877 | 3300042636 | Bacteria | 98275 |
| 161 | Ga0466704_294025 | 3300042643 | Bacteria | 7152 |
| 162 | Ga0466709_199853 | 3300042648 | Bacteria | 2812 |
| 163 | Ga0160431_104770 | 3300012828 | Bacteria | 2405 |
| 164 | Ga0160433_100368 | 3300012846 | Bacteria | 26229 |
| 165 | Ga0160445_100280 | 3300012847 | Bacteria | 33950 |
| 166 | Ga0160443_100327 | 3300012848 | Bacteria | 44155 |
| 167 | Ga0466692_169156 | 3300042591 | Bacteria | 59346 |
| 168 | Ga0466694_175619 | 3300042594 | Bacteria | 2665 |
| 169 | Ga0466696_004159 | 3300042596 | Bacteria | 9316 |
| 170 | Ga0466706_028908 | 3300042599 | Bacteria | 27379 |
| 171 | Ga0466706_138301 | 3300042599 | Bacteria | 29290 |
| 172 | Ga0466706_156906 | 3300042599 | Bacteria | 4906 |
| 173 | Ga0466700_137486 | 3300042600 | Bacteria | 5854 |
| 174 | Ga0466719_306626 | 3300042606 | Bacteria | 7564 |
| 175 | IMNBL1DRAFT_c0000088 | 3300000062 | Bacteria | 80215 |
| 176 | CVPL010W_10002748 | 3300002931 | Bacteria | 24536 |
| 177 | Ga0072941_1226800 | 3300005201 | Bacteria | 7719 |
| 178 | Ga0102736_1000106 | 3300007052 | Bacteria | 26068 |
| 179 | Ga0102735_1000030 | 3300007080 | Bacteria | 73717 |
| 180 | Ga0102740_1000220 | 3300007140 | Bacteria | 16312 |
| 181 | Ga0103268_1001540 | 3300007192 | Unclassified | 10722 |
| 182 | Ga0466705_296838 | 3300042612 | Bacteria | 15201 |
| 183 | Ga0466733_166692 | 3300042659 | Bacteria | 9523 |
| 184 | Ga0562378_0355 | 3300056814 | Bacteria | 89245 |
| 185 | Ga0562377_0071 | 3300056842 | Bacteria | 439264 |
| 186 | Ga0562375_5239 | 3300056856 | Bacteria | 8246 |
| 187 | Ga0123356_10000857 | 3300010049 | Unclassified | 33875 |
| 188 | Ga0123356_10002217 | 3300010049 | Bacteria | 20923 |
| 189 | Ga0123356_10042576 | 3300010049 | Bacteria | 4230 |
| 190 | Ga0123353_10044345 | 3300010167 | Bacteria | 7050 |
| 191 | Ga0123353_10064987 | 3300010167 | Unclassified | 5857 |
| 192 | Ga0123353_10091438 | 3300010167 | Bacteria | 4902 |
| 193 | Ga0160464_100594 | 3300012805 | Bacteria | 23577 |
| 194 | Ga0160466_103808 | 3300012809 | Bacteria | 2339 |
| 195 | Ga0466715_033684 | 3300042616 | Bacteria | 15295 |
| 196 | Ga0466723_038935 | 3300042618 | Bacteria | 2211 |
| 197 | Ga0466723_353883 | 3300042618 | Bacteria | 2535 |
| 198 | Ga0466728_320717 | 3300042620 | Bacteria | 40765 |
| 199 | Ga0466729_173068 | 3300042621 | Archaea | 2519 |
| 200 | Ga0466735_115119 | 3300042624 | Bacteria | 11278 |
| 201 | Ga0466735_156955 | 3300042624 | Bacteria | 5972 |
| 202 | Ga0466704_288212 | 3300042643 | Bacteria | 11956 |
| 203 | Ga0466704_350877 | 3300042643 | Bacteria | 6942 |
| 204 | Ga0466724_66581 | 3300042649 | Bacteria | 665985 |
| 205 | Ga0466708_231841 | 3300042652 | Bacteria | 67849 |
| 206 | Ga0466708_240824 | 3300042652 | Bacteria | 7216 |
| 207 | Ga0466708_265321 | 3300042652 | Bacteria | 14189 |
| 208 | Ga0466708_416110 | 3300042652 | Bacteria | 70714 |
| 209 | Ga0466708_453937 | 3300042652 | Bacteria | 13560 |
| 210 | Ga0466727_033664 | 3300042655 | Bacteria | 4729 |
| 211 | Ga0466727_335509 | 3300042655 | Bacteria | 1995 |
| 212 | Ga0160467_100220 | 3300012829 | Bacteria | 73452 |
| 213 | Ga0160457_1001346 | 3300012858 | Bacteria | 6961 |
| 214 | Ga0415639_028590 | 3300038395 | Bacteria | 5178 |
| 215 | Ga0415639_177472 | 3300038395 | Bacteria | 2309 |
| 216 | Ga0466699_153989 | 3300042597 | Bacteria | 13711 |
| 217 | Ga0466701_076067 | 3300042598 | Bacteria | 52733 |
| 218 | Ga0466701_079356 | 3300042598 | Bacteria | 4121 |
| 219 | Ga0466706_060587 | 3300042599 | Bacteria | 19790 |
| 220 | Ga0466707_343250 | 3300042601 | Bacteria | 2671 |
| 221 | Ga0466713_015872 | 3300042602 | Bacteria | 9979 |
| 222 | Ga0466713_115569 | 3300042602 | Bacteria | 9264 |
| 223 | Ga0466722_051638 | 3300042609 | Bacteria | 15472 |
| 224 | JGI24699J35502_11072256 | 3300002509 | Bacteria | 1860 |
| 225 | Ga0068302_10036884 | 3300005071 | Unclassified | 2842 |
| 226 | Ga0102736_1000057 | 3300007052 | Bacteria | 31963 |
| 227 | Ga0103266_1000044 | 3300007067 | Bacteria | 89495 |
| 228 | Ga0103260_1000014 | 3300007139 | Bacteria | 144579 |
| 229 | Ga0102738_1000007 | 3300007141 | Bacteria | 181972 |
| 230 | Ga0123357_10000615 | 3300009784 | Bacteria | 35314 |
| 231 | Ga0466705_042717 | 3300042612 | Bacteria | 21329 |
| 232 | Ga0123356_10000767 | 3300010049 | Bacteria | 35460 |
| 233 | Ga0123356_10003716 | 3300010049 | Bacteria | 15903 |
| 234 | Ga0123356_10003864 | 3300010049 | Bacteria | 15608 |
| 235 | Ga0123356_10045660 | 3300010049 | Bacteria | 4076 |
| 236 | Ga0123353_10001968 | 3300010167 | Bacteria | 25332 |
| 237 | Ga0123353_10005272 | 3300010167 | Bacteria | 16908 |
| 238 | Ga0123353_10019895 | 3300010167 | Bacteria | 9999 |
| 239 | Ga0123353_10036222 | 3300010167 | Bacteria | 7728 |
| 240 | Ga0123353_10368508 | 3300010167 | Bacteria | 2155 |
| 241 | Ga0123354_10093659 | 3300010882 | Bacteria | 4128 |
| 242 | Ga0160465_100152 | 3300012803 | Bacteria | 60106 |
| 243 | Ga0466705_498368 | 3300042612 | Bacteria | 11688 |
| 244 | Ga0466711_051710 | 3300042615 | Bacteria | 25077 |
| 245 | Ga0466715_059738 | 3300042616 | Bacteria | 13741 |
| 246 | Ga0466715_079488 | 3300042616 | Bacteria | 17871 |
| 247 | Ga0466715_170777 | 3300042616 | Bacteria | 2928 |
| 248 | Ga0466723_011755 | 3300042618 | Bacteria | 6044 |
| 249 | Ga0466723_012899 | 3300042618 | Bacteria | 3016 |
| 250 | Ga0466728_454134 | 3300042620 | Bacteria | 12943 |
| 251 | Ga0466729_043233 | 3300042621 | Bacteria | 2620 |
| 252 | Ga0466735_057798 | 3300042624 | Bacteria | 6194 |
| 253 | Ga0466735_081139 | 3300042624 | Bacteria | 4699 |
| 254 | Ga0466735_164792 | 3300042624 | Bacteria | 4036 |
| 255 | Ga0466703_313034 | 3300042636 | Bacteria | 8491 |
| 256 | Ga0466704_344496 | 3300042643 | Bacteria | 4954 |
| 257 | Ga0466704_395985 | 3300042643 | Bacteria | 4741 |
| 258 | Ga0466704_508228 | 3300042643 | Bacteria | 66197 |
| 259 | Ga0466709_288828 | 3300042648 | Bacteria | 18400 |
| 260 | Ga0466709_308129 | 3300042648 | Bacteria | 2835 |
| 261 | Ga0466724_08127 | 3300042649 | Bacteria | 26680 |
| 262 | Ga0466724_30060 | 3300042649 | Unclassified | 4314 |
| 263 | Ga0466724_46140 | 3300042649 | Bacteria | 630192 |
| 264 | Ga0160432_102495 | 3300012818 | Bacteria | 3847 |
| 265 | Ga0160431_104803 | 3300012828 | Bacteria | 2388 |
| 266 | Ga0160458_100263 | 3300012832 | Unclassified | 33700 |
| 267 | Ga0160433_100053 | 3300012846 | Bacteria | 130466 |
| 268 | Ga0160430_101833 | 3300012852 | Bacteria | 7368 |
| 269 | Ga0466691_110498 | 3300042593 | Bacteria | 6244 |
| 270 | Ga0466696_005003 | 3300042596 | Bacteria | 5482 |
| 271 | Ga0466696_023490 | 3300042596 | Bacteria | 3141 |
| 272 | Ga0466696_217649 | 3300042596 | Bacteria | 2244 |
| 273 | Ga0466701_010990 | 3300042598 | Bacteria | 332169 |
| 274 | Ga0466701_035380 | 3300042598 | Bacteria | 6995 |
| 275 | Ga0466706_030493 | 3300042599 | Bacteria | 13577 |
| 276 | Ga0466706_228217 | 3300042599 | Bacteria | 67941 |
| 277 | Ga0466707_168226 | 3300042601 | Bacteria | 11522 |
| 278 | Ga0466713_001026 | 3300042602 | Bacteria | 36059 |
| 279 | Ga0466714_055030 | 3300042603 | Bacteria | 6787 |
| 280 | 2227430793 | 2225789004 | Bacteria | 5571 |
| 281 | IMNBGM34_c000044 | 3300000036 | Bacteria | 34860 |
| 282 | JGI24695J34938_10001251 | 3300002450 | Bacteria | 22330 |
| 283 | CVPL010W_10000615 | 3300002931 | Unclassified | 52736 |
| 284 | Ga0072941_1147642 | 3300005201 | Unclassified | 3689 |
| 285 | Ga0102737_1001419 | 3300007142 | Unclassified | 6687 |
| 286 | Ga0103264_1015614 | 3300007188 | Bacteria | 3722 |
| 287 | Ga0466705_151059 | 3300042612 | Bacteria | 39890 |
| 288 | Ga0466705_343921 | 3300042612 | Bacteria | 17979 |
| 289 | Ga0123356_10000425 | 3300010049 | Bacteria | 48140 |
| 290 | Ga0123356_10000676 | 3300010049 | Bacteria | 37752 |
| 291 | Ga0123356_10019663 | 3300010049 | Bacteria | 6400 |
| 292 | Ga0123356_10030487 | 3300010049 | Bacteria | 5048 |
| 293 | Ga0123356_10040931 | 3300010049 | Bacteria | 4317 |
| 294 | Ga0123353_10181181 | 3300010167 | Bacteria | 3335 |
| 295 | Ga0160454_100001 | 3300012798 | Bacteria | 780029 |
| 296 | Ga0466715_001157 | 3300042616 | Bacteria | 44509 |
| 297 | Ga0466715_314467 | 3300042616 | Bacteria | 26093 |
| 298 | Ga0466715_321177 | 3300042616 | Bacteria | 8081 |
| 299 | Ga0466715_350435 | 3300042616 | Unclassified | 1872 |
| 300 | Ga0466726_200393 | 3300042619 | Bacteria | 4630 |
| 301 | Ga0466726_271206 | 3300042619 | Bacteria | 3999 |
| 302 | Ga0466726_345058 | 3300042619 | Bacteria | 18048 |
| 303 | Ga0466703_392640 | 3300042636 | Bacteria | 16164 |
| 304 | Ga0466704_453215 | 3300042643 | Bacteria | 5840 |
| 305 | Ga0466724_11157 | 3300042649 | Archaea | 1968 |
| 306 | Ga0466727_261820 | 3300042655 | Bacteria | 15247 |
| 307 | Ga0160441_100409 | 3300012825 | Bacteria | 35491 |
| 308 | Ga0466692_158668 | 3300042591 | Bacteria | 509148 |
| 309 | Ga0466691_063579 | 3300042593 | Bacteria | 12437 |
| 310 | Ga0466691_074227 | 3300042593 | Bacteria | 2281 |
| 311 | Ga0466694_034645 | 3300042594 | Bacteria | 15920 |
| 312 | Ga0466707_277610 | 3300042601 | Bacteria | 10435 |
| 313 | Ga0466713_040722 | 3300042602 | Bacteria | 16258 |
| 314 | Ga0466713_079531 | 3300042602 | Bacteria | 32951 |
| 315 | Ga0466714_153426 | 3300042603 | Bacteria | 5784 |
| 316 | Ga0466722_168692 | 3300042609 | Bacteria | 15443 |
| 317 | JGI24696J40584_12961142 | 3300002834 | Archaea | 11149 |
| 318 | Ga0072941_1035574 | 3300005201 | Bacteria | 9949 |
| 319 | Ga0103265_1000010 | 3300007068 | Bacteria | 47599 |
| 320 | Ga0103261_1000031 | 3300007083 | Bacteria | 447718 |
| 321 | Ga0102739_1000414 | 3300007095 | Unclassified | 25069 |
| 322 | Ga0104050_1005409 | 3300007153 | Unclassified | 10548 |
| 323 | Ga0466697_072335 | 3300042611 | Bacteria | 13627 |
| 324 | Ga0466705_336039 | 3300042612 | Bacteria | 4742 |
| 325 | Ga0562376_0018 | 3300056857 | Bacteria | 481690 |
| 326 | Ga0562374_0013 | 3300057007 | Bacteria | 1517757 |
| 327 | Ga0123356_10000473 | 3300010049 | Bacteria | 45077 |
| 328 | Ga0123356_10004719 | 3300010049 | Bacteria | 14042 |
| 329 | Ga0123356_10008333 | 3300010049 | Bacteria | 10310 |
| 330 | Ga0123356_10046959 | 3300010049 | Bacteria | 4018 |
| 331 | Ga0123356_10093482 | 3300010049 | Bacteria | 2870 |
| 332 | Ga0123353_10001983 | 3300010167 | Bacteria | 25286 |
| 333 | Ga0123353_10006872 | 3300010167 | Bacteria | 15276 |
| 334 | Ga0123353_10007831 | 3300010167 | Bacteria | 14507 |
| 335 | Ga0123353_10057794 | 3300010167 | Bacteria | 6214 |
| 336 | Ga0123354_10019215 | 3300010882 | Bacteria | 10726 |
| 337 | Ga0466705_481155 | 3300042612 | Bacteria | 3792 |
| 338 | Ga0466715_237416 | 3300042616 | Bacteria | 16444 |
| 339 | Ga0466723_004854 | 3300042618 | Bacteria | 12577 |
| 340 | Ga0466723_022972 | 3300042618 | Bacteria | 101765 |
| 341 | Ga0466723_213455 | 3300042618 | Bacteria | 6776 |
| 342 | Ga0466723_348373 | 3300042618 | Bacteria | 7676 |
| 343 | Ga0466726_098184 | 3300042619 | Bacteria | 19922 |
| 344 | Ga0466728_373369 | 3300042620 | Archaea | 2248 |
| 345 | Ga0466731_113174 | 3300042622 | Bacteria | 1863 |
| 346 | Ga0466735_087349 | 3300042624 | Bacteria | 5417 |
| 347 | Ga0466703_217671 | 3300042636 | Bacteria | 6856 |
| 348 | Ga0466704_258016 | 3300042643 | Bacteria | 2990 |
| 349 | Ga0466708_312416 | 3300042652 | Bacteria | 85118 |
| 350 | Ga0466727_155884 | 3300042655 | Bacteria | 6773 |
| 351 | Ga0160468_100137 | 3300012819 | Bacteria | 69665 |
| 352 | Ga0160467_101583 | 3300012829 | Unclassified | 8107 |
| 353 | Ga0466657_062863 | 3300042582 | Bacteria | 5178 |
| 354 | Ga0466690_109494 | 3300042590 | Bacteria | 8516 |
| 355 | Ga0466692_045732 | 3300042591 | Bacteria | 10384 |
| 356 | Ga0466692_161938 | 3300042591 | Bacteria | 121742 |
| 357 | Ga0466691_042808 | 3300042593 | Bacteria | 14280 |
| 358 | Ga0466706_014225 | 3300042599 | Bacteria | 6235 |
| 359 | Ga0466706_161207 | 3300042599 | Bacteria | 22327 |
| 360 | Ga0466706_164315 | 3300042599 | Bacteria | 60572 |
| 361 | Ga0466713_050983 | 3300042602 | Bacteria | 10911 |
| 362 | Ga0466714_008590 | 3300042603 | Unclassified | 2309 |
| 363 | Ga0466698_005253 | 3300042610 | Bacteria | 2085 |
| 364 | IMNBL1DRAFT_c0000879 | 3300000062 | Bacteria | 23426 |
| 365 | IMNBL1DRAFT_c0019906 | 3300000062 | Bacteria | 2733 |
| 366 | AustNasuHG_c1003867 | 3300000089 | Bacteria | 5394 |
| 367 | JGI24703J35330_11747896 | 3300002501 | Bacteria | 8938 |
| 368 | Ga0103263_100075 | 3300007042 | Bacteria | 55291 |
| 369 | Ga0103264_1000101 | 3300007188 | Bacteria | 49856 |
| 370 | Ga0103267_1000427 | 3300007190 | Bacteria | 14622 |
| 371 | Ga0127649_100531 | 3300009460 | Bacteria | 18197 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00205 | TPP_enzyme_M | Thiamine pyrophosphate enzyme, central domain | 270 | 405 | 0.98 |
| PF02775 | TPP_enzyme_C | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain | 476 | 642 | 0.96 |
| PF02776 | TPP_enzyme_N | Thiamine pyrophosphate enzyme, N-terminal TPP binding domain | 78 | 191 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02776 | GO:0030976 | thiamine pyrophosphate binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.