Protein Family IF03010
Metagenome
Isolate
296
Members
76
Samples
277
Scaffolds
270.64
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10000026|Ga0123353_1000002627
- Length
- 313 aa
- Sequence
- VTETKAEFTYSKLALKSGYPAGWKTHACVLDFLEFPKRQSYKSNTMSRILYVCQEITPYVADSEMATLCRTMSQAMQEAGNEVRTFMPRYGHINERRNQLHEVIRLSGMNLIIDDTDQQLIIKVASIPSARVQIYFIDNDDYFTRKAMLTDDEGVCFDDNDERAIFFSRGVLETVKKLRWGPEIVHCHGWFSAVAPIYLRHVFNDDPLFADVKIAVSLYDDAFPGALDEGFAEKLADEGVNKQTLEKLGEPTYENLMRFVIEHADGVVLAGGERPEGLEAWIEQTGKPVLRCLHTECDNYLEEYKKFYEEIL*
Sample Types
Isolate
6.4%
Metagenome
93.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.8%
Unclassified
28.4%
Kalotermitidae
18.9%
Rhinotermitidae
5.4%
Termopsidae
5.4%
Passalidae
2.7%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
273
Eukaryota
0
Viruses
1
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820786992 | Unclassified Bacteroidetes Emb289P1bin66 | Isolate | Unclassified |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 5 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 6 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 7 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 8 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 9 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 14 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 24 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 27 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 36 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 44 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 45 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 46 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 47 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 48 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 49 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 50 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 51 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 52 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 53 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 54 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 55 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 56 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 57 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 58 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 59 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 60 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 61 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 62 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 63 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 64 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 65 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 66 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 67 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 68 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 69 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 70 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 71 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 72 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 73 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 74 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 75 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 76 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_102061 | 3300042590 | Bacteria | 22951 |
| 2 | Ga0466693_090184 | 3300042592 | Unclassified | 1221 |
| 3 | Ga0466696_122246 | 3300042596 | Bacteria | 13557 |
| 4 | Ga0466696_376134 | 3300042596 | Bacteria | 3638 |
| 5 | Ga0123353_10743884 | 3300010167 | Bacteria | 1366 |
| 6 | IMNBL1DRAFT_c0046735 | 3300000062 | Bacteria | 1403 |
| 7 | JGI24695J34938_10003487 | 3300002450 | Bacteria | 10937 |
| 8 | Ga0072941_1287272 | 3300005201 | Bacteria | 1184 |
| 9 | Ga0466715_540931 | 3300042616 | Bacteria | 8372 |
| 10 | Ga0466723_286459 | 3300042618 | Bacteria | 22404 |
| 11 | Ga0466700_268385 | 3300042600 | Bacteria | 3060 |
| 12 | Ga0466714_153694 | 3300042603 | Unclassified | 4515 |
| 13 | Ga0466719_110359 | 3300042606 | Bacteria | 5031 |
| 14 | Ga0466719_169184 | 3300042606 | Bacteria | 7164 |
| 15 | Ga0466719_510922 | 3300042606 | Bacteria | 1523 |
| 16 | Ga0466735_105693 | 3300042624 | Bacteria | 6966 |
| 17 | Ga0466703_058730 | 3300042636 | Bacteria | 7994 |
| 18 | Ga0466704_019759 | 3300042643 | Bacteria | 8282 |
| 19 | Ga0466704_377212 | 3300042643 | Bacteria | 23470 |
| 20 | Ga0466704_510775 | 3300042643 | Unclassified | 2146 |
| 21 | Ga0466724_18750 | 3300042649 | Bacteria | 2475 |
| 22 | Ga0466708_093005 | 3300042652 | Bacteria | 17156 |
| 23 | Ga0466727_186915 | 3300042655 | Bacteria | 5068 |
| 24 | Ga0466732_196541 | 3300042656 | Bacteria | 122148 |
| 25 | Ga0466733_119117 | 3300042659 | Bacteria | 14612 |
| 26 | Ga0466690_278945 | 3300042590 | Bacteria | 14674 |
| 27 | Ga0466692_092953 | 3300042591 | Bacteria | 23013 |
| 28 | Ga0466692_108066 | 3300042591 | Bacteria | 15222 |
| 29 | Ga0466696_007511 | 3300042596 | Bacteria | 13104 |
| 30 | Ga0466696_016807 | 3300042596 | Bacteria | 10791 |
| 31 | Ga0123356_10113398 | 3300010049 | Bacteria | 2622 |
| 32 | Ga0123353_10015562 | 3300010167 | Bacteria | 11063 |
| 33 | Ga0123353_10018396 | 3300010167 | Bacteria | 10330 |
| 34 | Ga0123353_10568449 | 3300010167 | Bacteria | 1630 |
| 35 | JGI24702J35022_10002044 | 3300002462 | Bacteria | 12441 |
| 36 | JGI24705J35276_12232526 | 3300002504 | Unclassified | 4368 |
| 37 | Ga0068305_10124176 | 3300005083 | Unclassified | 4461 |
| 38 | Ga0466705_435327 | 3300042612 | Bacteria | 1769 |
| 39 | Ga0466710_103730 | 3300042613 | Bacteria | 1453 |
| 40 | Ga0466711_176231 | 3300042615 | Bacteria | 10764 |
| 41 | Ga0466715_263031 | 3300042616 | Bacteria | 3793 |
| 42 | Ga0466715_451506 | 3300042616 | Bacteria | 7579 |
| 43 | Ga0466715_524427 | 3300042616 | Bacteria | 3643 |
| 44 | Ga0466723_081623 | 3300042618 | Bacteria | 20806 |
| 45 | Ga0466723_153938 | 3300042618 | Bacteria | 19175 |
| 46 | Ga0466726_391473 | 3300042619 | Unclassified | 2234 |
| 47 | Ga0466728_413842 | 3300042620 | Bacteria | 32190 |
| 48 | Ga0466706_025877 | 3300042599 | Bacteria | 2613 |
| 49 | Ga0466706_203233 | 3300042599 | Bacteria | 13429 |
| 50 | Ga0466700_101670 | 3300042600 | Bacteria | 2253 |
| 51 | Ga0466707_369720 | 3300042601 | Bacteria | 2546 |
| 52 | Ga0466714_061341 | 3300042603 | Bacteria | 3272 |
| 53 | Ga0466714_143999 | 3300042603 | Bacteria | 4317 |
| 54 | Ga0466717_112476 | 3300042604 | Bacteria | 3217 |
| 55 | Ga0466719_239728 | 3300042606 | Bacteria | 6354 |
| 56 | Ga0466705_116962 | 3300042612 | Bacteria | 29892 |
| 57 | Ga0466731_003712 | 3300042622 | Bacteria | 24479 |
| 58 | Ga0466703_120078 | 3300042636 | Bacteria | 7994 |
| 59 | Ga0466703_403206 | 3300042636 | Bacteria | 2749 |
| 60 | Ga0466709_221860 | 3300042648 | Bacteria | 264751 |
| 61 | Ga0466709_375909 | 3300042648 | Bacteria | 6224 |
| 62 | Ga0466708_133641 | 3300042652 | Bacteria | 6888 |
| 63 | Ga0466708_410506 | 3300042652 | Bacteria | 6028 |
| 64 | Ga0466733_152806 | 3300042659 | Bacteria | 29753 |
| 65 | Ga0466656_048716 | 3300042550 | Bacteria | 5015 |
| 66 | Ga0466657_027724 | 3300042582 | Bacteria | 17890 |
| 67 | Ga0466694_321800 | 3300042594 | Bacteria | 29415 |
| 68 | Ga0466695_001740 | 3300042595 | Bacteria | 1200 |
| 69 | Ga0466695_306691 | 3300042595 | Bacteria | 1672 |
| 70 | Ga0466699_030202 | 3300042597 | Bacteria | 1432 |
| 71 | Ga0123354_10014924 | 3300010882 | Bacteria | 12104 |
| 72 | Ga0123354_10140137 | 3300010882 | Bacteria | 2997 |
| 73 | Ga0068305_10146876 | 3300005083 | Bacteria | 12973 |
| 74 | Ga0072941_1348613 | 3300005201 | Bacteria | 2816 |
| 75 | Ga0466710_307847 | 3300042613 | Bacteria | 1156 |
| 76 | Ga0466711_026551 | 3300042615 | Unclassified | 2689 |
| 77 | Ga0466711_356881 | 3300042615 | Bacteria | 3932 |
| 78 | Ga0466715_168691 | 3300042616 | Bacteria | 8855 |
| 79 | Ga0466715_307145 | 3300042616 | Bacteria | 8543 |
| 80 | Ga0466723_054242 | 3300042618 | Bacteria | 33723 |
| 81 | Ga0466723_314054 | 3300042618 | Bacteria | 8745 |
| 82 | Ga0466726_471805 | 3300042619 | Bacteria | 1311 |
| 83 | Ga0466707_290784 | 3300042601 | Bacteria | 9915 |
| 84 | Ga0466713_006416 | 3300042602 | Bacteria | 3607 |
| 85 | Ga0466713_131527 | 3300042602 | Bacteria | 55397 |
| 86 | Ga0466714_148624 | 3300042603 | Bacteria | 4353 |
| 87 | Ga0466717_015556 | 3300042604 | Bacteria | 1564 |
| 88 | Ga0466716_019812 | 3300042605 | Bacteria | 9191 |
| 89 | Ga0466722_226151 | 3300042609 | Bacteria | 6031 |
| 90 | Ga0466735_006345 | 3300042624 | Bacteria | 6160 |
| 91 | Ga0466703_059052 | 3300042636 | Bacteria | 3503 |
| 92 | Ga0466703_368321 | 3300042636 | Bacteria | 4075 |
| 93 | Ga0466703_369378 | 3300042636 | Bacteria | 6331 |
| 94 | Ga0466704_322453 | 3300042643 | Bacteria | 4032 |
| 95 | Ga0466704_490833 | 3300042643 | Bacteria | 16666 |
| 96 | Ga0466724_66043 | 3300042649 | Bacteria | 1620 |
| 97 | Ga0466708_259215 | 3300042652 | Bacteria | 28397 |
| 98 | Ga0466690_292035 | 3300042590 | Bacteria | 2414 |
| 99 | Ga0466690_410240 | 3300042590 | Bacteria | 17827 |
| 100 | Ga0466691_101778 | 3300042593 | Bacteria | 3532 |
| 101 | Ga0466691_183198 | 3300042593 | Bacteria | 6214 |
| 102 | Ga0466696_278072 | 3300042596 | Bacteria | 25130 |
| 103 | Ga0123356_10086240 | 3300010049 | Viruses | 2980 |
| 104 | Ga0123353_10677006 | 3300010167 | Bacteria | 1454 |
| 105 | Ga0123354_10162410 | 3300010882 | Bacteria | 2644 |
| 106 | Ga0123354_10181665 | 3300010882 | Unclassified | 2398 |
| 107 | Ga0123354_10236771 | 3300010882 | Bacteria | 1891 |
| 108 | IMNBL1DRAFT_c0010151 | 3300000062 | Bacteria | 4551 |
| 109 | Ga0123357_10001590 | 3300009784 | Bacteria | 24280 |
| 110 | Ga0466711_129276 | 3300042615 | Bacteria | 8151 |
| 111 | Ga0466711_189075 | 3300042615 | Bacteria | 10323 |
| 112 | Ga0466723_086397 | 3300042618 | Bacteria | 25409 |
| 113 | Ga0466729_113478 | 3300042621 | Bacteria | 2649 |
| 114 | Ga0466713_041641 | 3300042602 | Bacteria | 16534 |
| 115 | Ga0466713_068943 | 3300042602 | Bacteria | 16886 |
| 116 | Ga0466714_143089 | 3300042603 | Unclassified | 1841 |
| 117 | Ga0466719_183583 | 3300042606 | Bacteria | 1328 |
| 118 | Ga0466722_007100 | 3300042609 | Bacteria | 5552 |
| 119 | Ga0466722_137238 | 3300042609 | Bacteria | 1205 |
| 120 | Ga0466697_203228 | 3300042611 | Bacteria | 2594 |
| 121 | Ga0466705_041128 | 3300042612 | Bacteria | 36311 |
| 122 | Ga0466703_035890 | 3300042636 | Bacteria | 2591 |
| 123 | Ga0466703_312850 | 3300042636 | Unclassified | 4417 |
| 124 | Ga0466709_004798 | 3300042648 | Bacteria | 35368 |
| 125 | Ga0466709_288082 | 3300042648 | Bacteria | 89530 |
| 126 | Ga0466727_035235 | 3300042655 | Bacteria | 14696 |
| 127 | Ga0466732_408835 | 3300042656 | Bacteria | 9831 |
| 128 | Ga0466733_125372 | 3300042659 | Bacteria | 9286 |
| 129 | Ga0466733_159184 | 3300042659 | Bacteria | 21573 |
| 130 | Ga0466657_326060 | 3300042582 | Bacteria | 13466 |
| 131 | Ga0466690_128649 | 3300042590 | Unclassified | 3082 |
| 132 | Ga0466690_276223 | 3300042590 | Bacteria | 213056 |
| 133 | Ga0466692_167846 | 3300042591 | Bacteria | 1149 |
| 134 | Ga0466696_079982 | 3300042596 | Bacteria | 1423 |
| 135 | Ga0466696_161795 | 3300042596 | Bacteria | 76546 |
| 136 | Ga0466696_290018 | 3300042596 | Bacteria | 1480 |
| 137 | Ga0123356_10007295 | 3300010049 | Bacteria | 11035 |
| 138 | Ga0123353_10127446 | 3300010167 | Bacteria | 4088 |
| 139 | Ga0123353_10317798 | 3300010167 | Bacteria | 2365 |
| 140 | 2227508003 | 2225789004 | Unclassified | 3629 |
| 141 | IMNBL1DRAFT_c0016788 | 3300000062 | Bacteria | 3115 |
| 142 | JGI24705J35276_12218168 | 3300002504 | Unclassified | 2131 |
| 143 | JGI24696J40584_12959670 | 3300002834 | Bacteria | 5446 |
| 144 | Ga0072940_1185767 | 3300005200 | Bacteria | 2288 |
| 145 | Ga0466705_400134 | 3300042612 | Bacteria | 13122 |
| 146 | Ga0466710_372852 | 3300042613 | Bacteria | 1003 |
| 147 | Ga0466715_104659 | 3300042616 | Bacteria | 25493 |
| 148 | Ga0466715_480894 | 3300042616 | Bacteria | 19234 |
| 149 | Ga0466726_252531 | 3300042619 | Bacteria | 5013 |
| 150 | Ga0466726_421722 | 3300042619 | Bacteria | 3353 |
| 151 | Ga0466726_439763 | 3300042619 | Bacteria | 4093 |
| 152 | Ga0466700_132529 | 3300042600 | Bacteria | 3172 |
| 153 | Ga0466707_038496 | 3300042601 | Bacteria | 3768 |
| 154 | Ga0466707_124443 | 3300042601 | Bacteria | 9243 |
| 155 | Ga0466713_085543 | 3300042602 | Bacteria | 51640 |
| 156 | Ga0466714_010035 | 3300042603 | Bacteria | 2813 |
| 157 | Ga0466714_111320 | 3300042603 | Bacteria | 185233 |
| 158 | Ga0466722_057651 | 3300042609 | Bacteria | 3608 |
| 159 | Ga0466697_216571 | 3300042611 | Bacteria | 3345 |
| 160 | Ga0466697_271119 | 3300042611 | Unclassified | 1850 |
| 161 | Ga0466705_006212 | 3300042612 | Bacteria | 12430 |
| 162 | Ga0466735_073966 | 3300042624 | Bacteria | 12662 |
| 163 | Ga0466735_196645 | 3300042624 | Bacteria | 2420 |
| 164 | Ga0466704_007441 | 3300042643 | Bacteria | 9278 |
| 165 | Ga0466704_108271 | 3300042643 | Bacteria | 42780 |
| 166 | Ga0466708_182660 | 3300042652 | Bacteria | 7213 |
| 167 | Ga0466727_274506 | 3300042655 | Bacteria | 3915 |
| 168 | Ga0466733_026645 | 3300042659 | Bacteria | 1333 |
| 169 | Ga0466733_114504 | 3300042659 | Bacteria | 14161 |
| 170 | Ga0466657_287266 | 3300042582 | Bacteria | 16646 |
| 171 | Ga0466690_348486 | 3300042590 | Bacteria | 6060 |
| 172 | Ga0466693_353547 | 3300042592 | Unclassified | 1702 |
| 173 | Ga0466691_137298 | 3300042593 | Bacteria | 5724 |
| 174 | Ga0466694_199493 | 3300042594 | Bacteria | 8424 |
| 175 | Ga0466695_384124 | 3300042595 | Bacteria | 90029 |
| 176 | Ga0466696_380568 | 3300042596 | Bacteria | 1802 |
| 177 | Ga0123353_10000026 | 3300010167 | Bacteria | 168247 |
| 178 | Ga0123353_10025778 | 3300010167 | Bacteria | 8966 |
| 179 | IMNBL1DRAFT_c0001973 | 3300000062 | Bacteria | 14774 |
| 180 | IMNBL1DRAFT_c0006054 | 3300000062 | Bacteria | 6729 |
| 181 | IMNBL1DRAFT_c0009380 | 3300000062 | Bacteria | 4832 |
| 182 | JGI24698J34947_10037059 | 3300002449 | Bacteria | 2536 |
| 183 | JGI24696J40584_12956727 | 3300002834 | Bacteria | 3208 |
| 184 | JGI24696J40584_12959793 | 3300002834 | Bacteria | 5654 |
| 185 | Ga0466711_037672 | 3300042615 | Bacteria | 7262 |
| 186 | Ga0466711_062533 | 3300042615 | Bacteria | 5489 |
| 187 | Ga0466711_337838 | 3300042615 | Bacteria | 2677 |
| 188 | Ga0466723_021308 | 3300042618 | Bacteria | 5037 |
| 189 | Ga0466726_039017 | 3300042619 | Unclassified | 4995 |
| 190 | Ga0466728_188587 | 3300042620 | Bacteria | 16055 |
| 191 | Ga0466701_059118 | 3300042598 | Bacteria | 32938 |
| 192 | Ga0466706_144986 | 3300042599 | Bacteria | 14894 |
| 193 | Ga0466706_227496 | 3300042599 | Bacteria | 47663 |
| 194 | Ga0466714_086334 | 3300042603 | Bacteria | 4218 |
| 195 | Ga0466714_099031 | 3300042603 | Bacteria | 1781 |
| 196 | Ga0466714_120156 | 3300042603 | Bacteria | 1482 |
| 197 | Ga0466705_384938 | 3300042612 | Bacteria | 4919 |
| 198 | Ga0466703_192334 | 3300042636 | Bacteria | 7560 |
| 199 | Ga0466704_378891 | 3300042643 | Bacteria | 31782 |
| 200 | Ga0466732_167039 | 3300042656 | Bacteria | 2571 |
| 201 | Ga0466733_083612 | 3300042659 | Bacteria | 2249 |
| 202 | Ga0466733_087428 | 3300042659 | Bacteria | 2196 |
| 203 | Ga0265387_1001495 | 3300024582 | Bacteria | 3431 |
| 204 | Ga0466690_083281 | 3300042590 | Bacteria | 17372 |
| 205 | Ga0466690_292742 | 3300042590 | Bacteria | 9263 |
| 206 | Ga0466691_026802 | 3300042593 | Bacteria | 5895 |
| 207 | Ga0466691_078647 | 3300042593 | Bacteria | 5013 |
| 208 | Ga0466695_233211 | 3300042595 | Bacteria | 1750 |
| 209 | Ga0466696_260243 | 3300042596 | Bacteria | 2909 |
| 210 | Ga0466696_383977 | 3300042596 | Bacteria | 8176 |
| 211 | Ga0123355_10000865 | 3300009826 | Bacteria | 41779 |
| 212 | Ga0123356_10199593 | 3300010049 | Bacteria | 2039 |
| 213 | Ga0123356_10284015 | 3300010049 | Bacteria | 1752 |
| 214 | Ga0123353_10027034 | 3300010167 | Bacteria | 8783 |
| 215 | Ga0123353_10259385 | 3300010167 | Unclassified | 2686 |
| 216 | Ga0123353_10389095 | 3300010167 | Bacteria | 2081 |
| 217 | Ga0123353_10499607 | 3300010167 | Bacteria | 1773 |
| 218 | Ga0123354_10000758 | 3300010882 | Bacteria | 34945 |
| 219 | Ga0123354_10138693 | 3300010882 | Bacteria | 3024 |
| 220 | JGI24702J35022_10013252 | 3300002462 | Bacteria | 4568 |
| 221 | Ga0068302_10056872 | 3300005071 | Bacteria | 4979 |
| 222 | Ga0072940_1364060 | 3300005200 | Bacteria | 2624 |
| 223 | Ga0466710_203411 | 3300042613 | Bacteria | 3961 |
| 224 | Ga0466715_097699 | 3300042616 | Bacteria | 8322 |
| 225 | Ga0466715_211286 | 3300042616 | Bacteria | 28788 |
| 226 | Ga0466715_412401 | 3300042616 | Bacteria | 27380 |
| 227 | Ga0466715_455237 | 3300042616 | Bacteria | 5704 |
| 228 | Ga0466723_172103 | 3300042618 | Unclassified | 28593 |
| 229 | Ga0466726_039608 | 3300042619 | Bacteria | 1782 |
| 230 | Ga0466707_183760 | 3300042601 | Bacteria | 1435 |
| 231 | Ga0466707_417653 | 3300042601 | Bacteria | 13343 |
| 232 | Ga0466714_083865 | 3300042603 | Bacteria | 5565 |
| 233 | Ga0466714_155404 | 3300042603 | Bacteria | 9397 |
| 234 | Ga0466716_100029 | 3300042605 | Bacteria | 4514 |
| 235 | Ga0466716_533282 | 3300042605 | Bacteria | 1818 |
| 236 | Ga0466719_445466 | 3300042606 | Bacteria | 9216 |
| 237 | Ga0466722_207309 | 3300042609 | Bacteria | 1172 |
| 238 | Ga0466705_105916 | 3300042612 | Bacteria | 3320 |
| 239 | Ga0466729_254300 | 3300042621 | Unclassified | 5002 |
| 240 | Ga0466731_142732 | 3300042622 | Bacteria | 1076 |
| 241 | Ga0466703_024806 | 3300042636 | Bacteria | 17275 |
| 242 | Ga0466724_31442 | 3300042649 | Bacteria | 7751 |
| 243 | Ga0466727_238743 | 3300042655 | Bacteria | 3663 |
| 244 | Ga0466732_097661 | 3300042656 | Bacteria | 1311 |
| 245 | Ga0466733_020774 | 3300042659 | Bacteria | 9120 |
| 246 | Ga0466733_115246 | 3300042659 | Bacteria | 19889 |
| 247 | Ga0466656_344271 | 3300042550 | Unclassified | 2652 |
| 248 | Ga0466690_045334 | 3300042590 | Bacteria | 11475 |
| 249 | Ga0466690_162152 | 3300042590 | Bacteria | 7278 |
| 250 | Ga0466693_079816 | 3300042592 | Unclassified | 1078 |
| 251 | Ga0466691_199426 | 3300042593 | Bacteria | 29697 |
| 252 | Ga0466696_116408 | 3300042596 | Bacteria | 3491 |
| 253 | Ga0466696_174272 | 3300042596 | Bacteria | 7194 |
| 254 | Ga0466699_041154 | 3300042597 | Bacteria | 2816 |
| 255 | Ga0123355_10000211 | 3300009826 | Bacteria | 73196 |
| 256 | Ga0123353_10000298 | 3300010167 | Bacteria | 61891 |
| 257 | Ga0123354_10120778 | 3300010882 | Bacteria | 3386 |
| 258 | Ga0123354_10131857 | 3300010882 | Bacteria | 3151 |
| 259 | 2227610457 | 2225789004 | Bacteria | 2265 |
| 260 | JGI24699J35502_11134218 | 3300002509 | Bacteria | 66161 |
| 261 | Ga0068302_10413886 | 3300005071 | Bacteria | 1702 |
| 262 | Ga0466705_400956 | 3300042612 | Bacteria | 24773 |
| 263 | Ga0466710_322236 | 3300042613 | Bacteria | 1519 |
| 264 | Ga0466715_352153 | 3300042616 | Bacteria | 14991 |
| 265 | Ga0466723_156863 | 3300042618 | Bacteria | 3822 |
| 266 | Ga0466726_476211 | 3300042619 | Bacteria | 2575 |
| 267 | Ga0466701_027442 | 3300042598 | Bacteria | 43852 |
| 268 | Ga0466707_009455 | 3300042601 | Bacteria | 1650 |
| 269 | Ga0466713_025722 | 3300042602 | Bacteria | 16105 |
| 270 | Ga0466714_115350 | 3300042603 | Bacteria | 92077 |
| 271 | Ga0466714_170375 | 3300042603 | Bacteria | 8634 |
| 272 | Ga0466716_071929 | 3300042605 | Bacteria | 9828 |
| 273 | Ga0466722_033950 | 3300042609 | Bacteria | 1613 |
| 274 | Ga0466697_236627 | 3300042611 | Bacteria | 7049 |
| 275 | Ga0466731_010461 | 3300042622 | Bacteria | 2020 |
| 276 | Ga0466735_052065 | 3300042624 | Bacteria | 16014 |
| 277 | Ga0466703_045625 | 3300042636 | Unclassified | 1388 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08323 | Glyco_transf_5 | Starch synthase catalytic domain | 48 | 268 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.