Protein Family IF02977
Metagenome
Metatranscriptome
Isolate
140
Members
68
Samples
122
Scaffolds
179.69
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_11572569|Ga0123356_115725691
- Length
- 206 aa
- Sequence
- MFTSTLWNPAFAGMTRGQTLKSTMSRIGKKPIVLPQGVKVAIDGQTLTVEGSLGKLSQWFSPNVNVAFDSASNAITVTRANDSREAAAMHGLYRALFQNMVDGVSKGYEKRLEIFGTGYLFAMAGQTLQVRAGFAHEVHRKVPVGLTVTCPDQTHVSIKGIDKQLVGQFAADVRSIRKAEPYLGKGIKYEGEVIRRKESKAAAKK*
Sample Types
Isolate
12.9%
Metagenome
86.4%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.8%
Unclassified
22.7%
Kalotermitidae
21.2%
Rhinotermitidae
6.1%
Termopsidae
4.5%
Blattidae
3.0%
Culicidae
1.5%
Panorpidae
1.5%
Vespidae
1.5%
Tenebrionidae
1.5%
Hodotermitidae
1.5%
Passalidae
1.5%
Carabidae
1.5%
Taxonomy
Archaea
0
Bacteria
122
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 2 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 3 | 2558860238 | Spiroplasma sabaudiense Ar-1343 | Isolate | Culicidae |
| 4 | 2563366538 | Mesoplasma syrphidae ATCC 51578 | Isolate | Unclassified |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 14 | 2540341224 | Williamsoniiplasma luminosum ATCC 49195 | Isolate | Unclassified |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 31 | 2843673047 | Spiroplasma alleghenense PLHS-1 | Isolate | Panorpidae |
| 32 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 33 | 2597490379 | Entomoplasma freundtii ATCC 51999 | Isolate | Unclassified |
| 34 | 2791355053 | Spiroplasma monobiae MQ-1 | Isolate | Vespidae |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 46 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 2820711732 | Unclassified Firmicutes Co191P1bin26 | Isolate | Unclassified |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 52 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 53 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 54 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 58 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 59 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 60 | 8002448939 | Spiroplasma endosymbiont of 'Nebria riversi' Nriv7 | Isolate | Carabidae |
| 61 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 62 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 63 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 64 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 65 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 66 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 68 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562376_0009 | 3300056857 | Bacteria | 1013235 |
| 2 | Ga0466713_080378 | 3300042602 | Bacteria | 107053 |
| 3 | Ga0466717_074608 | 3300042604 | Unclassified | 2715 |
| 4 | Ga0466717_311387 | 3300042604 | Bacteria | 1594 |
| 5 | Ga0466698_196713 | 3300042610 | Bacteria | 2601 |
| 6 | Ga0466698_254956 | 3300042610 | Unclassified | 1011 |
| 7 | Ga0466718_076065 | 3300042617 | Unclassified | 2460 |
| 8 | Ga0466726_395357 | 3300042619 | Bacteria | 1591 |
| 9 | 2227333882 | 2225789004 | Unclassified | 1168 |
| 10 | JGI24702J35022_10099618 | 3300002462 | Bacteria | 1589 |
| 11 | Ga0233288_1041863 | 3300022232 | Unclassified | 761 |
| 12 | Ga0265387_1019382 | 3300024582 | Bacteria | 1005 |
| 13 | Ga0466693_294950 | 3300042592 | Bacteria | 2246 |
| 14 | Ga0466691_014205 | 3300042593 | Bacteria | 3350 |
| 15 | Ga0466695_274077 | 3300042595 | Bacteria | 3111 |
| 16 | Ga0466703_027809 | 3300042636 | Bacteria | 17782 |
| 17 | Ga0466704_266748 | 3300042643 | Bacteria | 3753 |
| 18 | Ga0123353_10052417 | 3300010167 | Bacteria | 6515 |
| 19 | Ga0123353_10074153 | 3300010167 | Bacteria | 5470 |
| 20 | Ga0123353_10590476 | 3300010167 | Unclassified | 1591 |
| 21 | Ga0123354_10071718 | 3300010882 | Bacteria | 4996 |
| 22 | Ga0466698_006313 | 3300042610 | Bacteria | 3062 |
| 23 | Ga0466698_195105 | 3300042610 | Bacteria | 1123 |
| 24 | Ga0466715_040462 | 3300042616 | Bacteria | 20601 |
| 25 | Ga0466729_050016 | 3300042621 | Bacteria | 1573 |
| 26 | Ga0466690_195374 | 3300042590 | Bacteria | 14018 |
| 27 | Ga0466729_281099 | 3300042621 | Bacteria | 22845 |
| 28 | Ga0123356_10035179 | 3300010049 | Bacteria | 4681 |
| 29 | Ga0123356_10045407 | 3300010049 | Bacteria | 4088 |
| 30 | Ga0123356_10426680 | 3300010049 | Bacteria | 1469 |
| 31 | Ga0123353_10003626 | 3300010167 | Bacteria | 19570 |
| 32 | Ga0123353_10006906 | 3300010167 | Bacteria | 15250 |
| 33 | Ga0123353_10113317 | 3300010167 | Unclassified | 4365 |
| 34 | Ga0123353_10134928 | 3300010167 | Bacteria | 3959 |
| 35 | Ga0123353_10173167 | 3300010167 | Bacteria | 3424 |
| 36 | Ga0123353_10835688 | 3300010167 | Bacteria | 1265 |
| 37 | Ga0466700_183925 | 3300042600 | Bacteria | 1221 |
| 38 | Ga0466700_280315 | 3300042600 | Bacteria | 1015 |
| 39 | Ga0466719_471494 | 3300042606 | Bacteria | 23771 |
| 40 | Ga0466722_259883 | 3300042609 | Bacteria | 1604 |
| 41 | Ga0466722_262143 | 3300042609 | Bacteria | 1333 |
| 42 | Ga0466711_011735 | 3300042615 | Bacteria | 27241 |
| 43 | Ga0466718_013019 | 3300042617 | Bacteria | 2069 |
| 44 | Ga0466723_078213 | 3300042618 | Bacteria | 19238 |
| 45 | Ga0466726_314729 | 3300042619 | Bacteria | 22256 |
| 46 | Ga0466729_104088 | 3300042621 | Bacteria | 1005 |
| 47 | JGI24695J34938_10174547 | 3300002450 | Unclassified | 888 |
| 48 | Ga0466729_247559 | 3300042621 | Bacteria | 2914 |
| 49 | Ga0466727_281726 | 3300042655 | Bacteria | 41168 |
| 50 | Ga0123355_11194710 | 3300009826 | Bacteria | 777 |
| 51 | Ga0123356_10027610 | 3300010049 | Bacteria | 5319 |
| 52 | Ga0123356_10152495 | 3300010049 | Bacteria | 2296 |
| 53 | Ga0123356_11009113 | 3300010049 | Bacteria | 1002 |
| 54 | Ga0123353_10003206 | 3300010167 | Bacteria | 20594 |
| 55 | Ga0466716_093411 | 3300042605 | Bacteria | 28339 |
| 56 | Ga0466711_303119 | 3300042615 | Bacteria | 30132 |
| 57 | Ga0466711_353449 | 3300042615 | Bacteria | 8615 |
| 58 | Ga0072940_1177212 | 3300005200 | Bacteria | 2283 |
| 59 | Ga0072940_1435027 | 3300005200 | Unclassified | 680 |
| 60 | Ga0456237_0000175 | 3300041968 | Bacteria | 9249 |
| 61 | Ga0466695_120450 | 3300042595 | Bacteria | 1131 |
| 62 | Ga0466727_116515 | 3300042655 | Bacteria | 2588 |
| 63 | Ga0123356_11572569 | 3300010049 | Bacteria | 813 |
| 64 | Ga0123353_10063205 | 3300010167 | Bacteria | 5938 |
| 65 | Ga0466717_195630 | 3300042604 | Unclassified | 1017 |
| 66 | Ga0466712_242941 | 3300042614 | Bacteria | 1536 |
| 67 | JGI24695J34938_10020157 | 3300002450 | Unclassified | 3286 |
| 68 | JGI24695J34938_10030992 | 3300002450 | Bacteria | 2486 |
| 69 | JGI24695J34938_10148841 | 3300002450 | Bacteria | 959 |
| 70 | JGI24702J35022_10009837 | 3300002462 | Bacteria | 5359 |
| 71 | Ga0072941_1011813 | 3300005201 | Bacteria | 2028 |
| 72 | Ga0466695_068283 | 3300042595 | Bacteria | 1192 |
| 73 | Ga0466733_166825 | 3300042659 | Bacteria | 2537 |
| 74 | Ga0123357_10282221 | 3300009784 | Bacteria | 1713 |
| 75 | Ga0123353_10004114 | 3300010167 | Bacteria | 18644 |
| 76 | Ga0123353_10198166 | 3300010167 | Bacteria | 3163 |
| 77 | Ga0123353_10214216 | 3300010167 | Bacteria | 3019 |
| 78 | Ga0123353_10260259 | 3300010167 | Bacteria | 2680 |
| 79 | Ga0123353_11812871 | 3300010167 | Bacteria | 758 |
| 80 | Ga0466706_268580 | 3300042599 | Bacteria | 2420 |
| 81 | Ga0466707_096099 | 3300042601 | Bacteria | 1395 |
| 82 | Ga0466713_057364 | 3300042602 | Unclassified | 1435 |
| 83 | Ga0466717_108484 | 3300042604 | Bacteria | 2799 |
| 84 | Ga0466722_204320 | 3300042609 | Bacteria | 6456 |
| 85 | Ga0466715_411196 | 3300042616 | Bacteria | 15845 |
| 86 | Ga0466692_094526 | 3300042591 | Bacteria | 14497 |
| 87 | Ga0466735_089867 | 3300042624 | Unclassified | 1518 |
| 88 | Ga0466727_143548 | 3300042655 | Bacteria | 9127 |
| 89 | Ga0466727_220273 | 3300042655 | Unclassified | 1020 |
| 90 | Ga0466705_120738 | 3300042612 | Unclassified | 4094 |
| 91 | Ga0123355_10150493 | 3300009826 | Bacteria | 3536 |
| 92 | Ga0123355_10267474 | 3300009826 | Bacteria | 2381 |
| 93 | Ga0123353_11180353 | 3300010167 | Bacteria | 1007 |
| 94 | Ga0123353_11272122 | 3300010167 | Bacteria | 958 |
| 95 | Ga0466700_110060 | 3300042600 | Bacteria | 2507 |
| 96 | Ga0466707_146874 | 3300042601 | Bacteria | 3712 |
| 97 | Ga0466719_139802 | 3300042606 | Bacteria | 15189 |
| 98 | Ga0466728_021417 | 3300042620 | Bacteria | 3409 |
| 99 | 2227464570 | 2225789004 | Bacteria | 983 |
| 100 | JGI24703J35330_11560512 | 3300002501 | Bacteria | 1251 |
| 101 | Ga0068305_10008099 | 3300005083 | Bacteria | 232741 |
| 102 | Ga0068305_10590872 | 3300005083 | Bacteria | 3598 |
| 103 | Ga0466693_411260 | 3300042592 | Bacteria | 1049 |
| 104 | Ga0466708_105321 | 3300042652 | Bacteria | 23379 |
| 105 | Ga0466708_367339 | 3300042652 | Bacteria | 21747 |
| 106 | Ga0466727_234666 | 3300042655 | Bacteria | 2117 |
| 107 | Ga0123354_10561286 | 3300010882 | Unclassified | 855 |
| 108 | Ga0466706_215819 | 3300042599 | Bacteria | 3628 |
| 109 | Ga0466700_202321 | 3300042600 | Bacteria | 13188 |
| 110 | Ga0466714_150928 | 3300042603 | Bacteria | 1900 |
| 111 | Ga0466716_433152 | 3300042605 | Unclassified | 7081 |
| 112 | Ga0466721_395616 | 3300042608 | Unclassified | 1228 |
| 113 | Ga0466723_174137 | 3300042618 | Bacteria | 37600 |
| 114 | Ga0466726_162254 | 3300042619 | Bacteria | 10355 |
| 115 | Ga0466656_238842 | 3300042550 | Bacteria | 2086 |
| 116 | Ga0466693_184501 | 3300042592 | Bacteria | 1736 |
| 117 | Ga0466696_037048 | 3300042596 | Bacteria | 24718 |
| 118 | Ga0466696_148402 | 3300042596 | Bacteria | 10906 |
| 119 | Ga0466703_135054 | 3300042636 | Bacteria | 5637 |
| 120 | Ga0466703_368547 | 3300042636 | Bacteria | 13848 |
| 121 | Ga0466704_528582 | 3300042643 | Bacteria | 8826 |
| 122 | Ga0466709_012862 | 3300042648 | Bacteria | 2145 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00347 | Ribosomal_L6 | Ribosomal protein L6 | 35 | 107 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.