Protein Family IF02743
Metagenome
Metatranscriptome
Isolate
184
Members
63
Samples
178
Scaffolds
182.43
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10037294|Ga0123356_100372942
- Length
- 205 aa
- Sequence
- LEKRVFSSIFAKKSKIKSFNQSHYSSPMELPVGTRIDHPKYGEGVISRNTQLAYKVIFIRGGEIEFIKSNFDAEVLEENDDMPVKEPRLNVRELEKMLKHVLDKYNGLEHRVELGSKWEGGTLTMKPGKEGLQAKEIPIETFFHKIVMVRDRLRVLEQNINSHKVLSDEDKINLQQYITRVYGSLTTFNVLFSEKEDYFTGSKA*
Sample Types
Isolate
3.3%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.5%
Kalotermitidae
23.0%
Unclassified
14.8%
Termopsidae
4.9%
Passalidae
3.3%
Rhinotermitidae
3.3%
Hodotermitidae
1.6%
Culicidae
1.6%
Taxonomy
Archaea
1
Bacteria
169
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 16 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 17 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 18 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 26 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 30 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 2820786992 | Unclassified Bacteroidetes Emb289P1bin66 | Isolate | Unclassified |
| 40 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 41 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 46 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 47 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 48 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 49 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 50 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 51 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 52 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 53 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 54 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 55 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 56 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 57 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 58 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 59 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 60 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 63 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_225534 | 3300042611 | Bacteria | 2078 |
| 2 | Ga0466727_285656 | 3300042655 | Bacteria | 6160 |
| 3 | Ga0466719_132037 | 3300042606 | Bacteria | 8118 |
| 4 | Ga0466656_304250 | 3300042550 | Bacteria | 4745 |
| 5 | Ga0466693_019815 | 3300042592 | Bacteria | 2357 |
| 6 | Ga0466693_344862 | 3300042592 | Bacteria | 1191 |
| 7 | Ga0466694_318570 | 3300042594 | Bacteria | 1157 |
| 8 | Ga0466696_167826 | 3300042596 | Bacteria | 25872 |
| 9 | Ga0123353_10360679 | 3300010167 | Bacteria | 2184 |
| 10 | Ga0123353_10489452 | 3300010167 | Bacteria | 1796 |
| 11 | Ga0123354_10161217 | 3300010882 | Bacteria | 2661 |
| 12 | JGI24702J35022_10000052 | 3300002462 | Bacteria | 49045 |
| 13 | JGI24705J35276_11917535 | 3300002504 | Unclassified | 765 |
| 14 | JGI24696J40584_12709237 | 3300002834 | Unclassified | 746 |
| 15 | JGI24696J40584_12959776 | 3300002834 | Bacteria | 5621 |
| 16 | Ga0466710_317446 | 3300042613 | Bacteria | 1542 |
| 17 | Ga0466711_235923 | 3300042615 | Bacteria | 4956 |
| 18 | Ga0466723_069574 | 3300042618 | Bacteria | 6551 |
| 19 | Ga0466697_182351 | 3300042611 | Bacteria | 8295 |
| 20 | Ga0466734_052015 | 3300042623 | Bacteria | 2156 |
| 21 | Ga0466703_252157 | 3300042636 | Bacteria | 5129 |
| 22 | Ga0466704_555533 | 3300042643 | Bacteria | 1943 |
| 23 | Ga0466709_123085 | 3300042648 | Bacteria | 10890 |
| 24 | Ga0466708_330610 | 3300042652 | Bacteria | 11894 |
| 25 | Ga0466725_078708 | 3300042654 | Bacteria | 2300 |
| 26 | Ga0466701_086009 | 3300042598 | Bacteria | 1340 |
| 27 | Ga0466707_307280 | 3300042601 | Unclassified | 3410 |
| 28 | Ga0466713_034961 | 3300042602 | Bacteria | 28922 |
| 29 | Ga0466722_249719 | 3300042609 | Bacteria | 1783 |
| 30 | Ga0466696_005413 | 3300042596 | Bacteria | 7145 |
| 31 | Ga0466696_398015 | 3300042596 | Unclassified | 1121 |
| 32 | Ga0123355_10050510 | 3300009826 | Bacteria | 6755 |
| 33 | Ga0123356_10170523 | 3300010049 | Bacteria | 2186 |
| 34 | Ga0123356_10794004 | 3300010049 | Bacteria | 1118 |
| 35 | Ga0123353_10804508 | 3300010167 | Bacteria | 1297 |
| 36 | Ga0123354_10409824 | 3300010882 | Unclassified | 1138 |
| 37 | IMNBL1DRAFT_c0012043 | 3300000062 | Bacteria | 3985 |
| 38 | JGI24702J35022_10000890 | 3300002462 | Bacteria | 18538 |
| 39 | JGI24696J40584_12942583 | 3300002834 | Bacteria | 1745 |
| 40 | Ga0105524_103918 | 3300007733 | Bacteria | 1966 |
| 41 | Ga0466710_005051 | 3300042613 | Bacteria | 2194 |
| 42 | Ga0466710_108813 | 3300042613 | Unclassified | 3567 |
| 43 | Ga0466697_182648 | 3300042611 | Bacteria | 1425 |
| 44 | Ga0466733_012746 | 3300042659 | Bacteria | 6069 |
| 45 | Ga0466702_082779 | 3300042635 | Bacteria | 1296 |
| 46 | Ga0466702_445842 | 3300042635 | Bacteria | 1522 |
| 47 | Ga0466703_101060 | 3300042636 | Bacteria | 3734 |
| 48 | Ga0466700_275278 | 3300042600 | Bacteria | 2890 |
| 49 | Ga0466693_390153 | 3300042592 | Unclassified | 1521 |
| 50 | Ga0466695_112736 | 3300042595 | Bacteria | 1130 |
| 51 | Ga0466695_289405 | 3300042595 | Bacteria | 5949 |
| 52 | Ga0466696_107652 | 3300042596 | Bacteria | 2690 |
| 53 | Ga0466696_435689 | 3300042596 | Bacteria | 2453 |
| 54 | Ga0123356_10037294 | 3300010049 | Bacteria | 4536 |
| 55 | Ga0123356_10800328 | 3300010049 | Bacteria | 1114 |
| 56 | Ga0123356_11426651 | 3300010049 | Bacteria | 852 |
| 57 | Ga0123353_10425628 | 3300010167 | Bacteria | 1965 |
| 58 | Ga0123353_11503183 | 3300010167 | Bacteria | 858 |
| 59 | 2227091655 | 2225789004 | Bacteria | 1832 |
| 60 | IMNBL1DRAFT_c0003672 | 3300000062 | Bacteria | 9676 |
| 61 | JGI24702J35022_10020715 | 3300002462 | Bacteria | 3567 |
| 62 | JGI24702J35022_10028240 | 3300002462 | Bacteria | 3016 |
| 63 | JGI24696J40584_12694445 | 3300002834 | Bacteria | 732 |
| 64 | Ga0068305_10892863 | 3300005083 | Bacteria | 1945 |
| 65 | Ga0466712_078993 | 3300042614 | Bacteria | 1454 |
| 66 | Ga0466715_247946 | 3300042616 | Unclassified | 1218 |
| 67 | Ga0466715_477561 | 3300042616 | Bacteria | 36126 |
| 68 | Ga0466723_077918 | 3300042618 | Bacteria | 13441 |
| 69 | Ga0466723_179975 | 3300042618 | Bacteria | 21814 |
| 70 | Ga0466729_011708 | 3300042621 | Bacteria | 3397 |
| 71 | Ga0466697_162522 | 3300042611 | Bacteria | 1802 |
| 72 | Ga0466731_334875 | 3300042622 | Bacteria | 1224 |
| 73 | Ga0466727_247343 | 3300042655 | Bacteria | 10852 |
| 74 | Ga0466700_103876 | 3300042600 | Bacteria | 3235 |
| 75 | Ga0466700_492309 | 3300042600 | Bacteria | 1696 |
| 76 | Ga0466714_107454 | 3300042603 | Bacteria | 2297 |
| 77 | Ga0466717_287584 | 3300042604 | Bacteria | 2196 |
| 78 | Ga0466722_028185 | 3300042609 | Bacteria | 38347 |
| 79 | Ga0466722_107470 | 3300042609 | Bacteria | 1031 |
| 80 | Ga0466722_203269 | 3300042609 | Bacteria | 1082 |
| 81 | Ga0466694_292093 | 3300042594 | Bacteria | 3116 |
| 82 | Ga0466699_167486 | 3300042597 | Bacteria | 2141 |
| 83 | Ga0123355_10000003 | 3300009826 | Bacteria | 224088 |
| 84 | Ga0123356_12759296 | 3300010049 | Bacteria | 615 |
| 85 | Ga0123353_10000433 | 3300010167 | Bacteria | 51855 |
| 86 | Ga0123353_11029176 | 3300010167 | Bacteria | 1103 |
| 87 | Ga0123353_11688774 | 3300010167 | Unclassified | 794 |
| 88 | JGI24695J34938_10266966 | 3300002450 | Bacteria | 731 |
| 89 | JGI24702J35022_10007109 | 3300002462 | Bacteria | 6433 |
| 90 | JGI24702J35022_10213338 | 3300002462 | Bacteria | 1109 |
| 91 | Ga0466726_244062 | 3300042619 | Archaea | 5219 |
| 92 | Ga0466705_278658 | 3300042612 | Bacteria | 1283 |
| 93 | Ga0466732_277015 | 3300042656 | Bacteria | 1637 |
| 94 | Ga0466709_260379 | 3300042648 | Bacteria | 1728 |
| 95 | Ga0466706_169827 | 3300042599 | Bacteria | 1129 |
| 96 | Ga0466698_078236 | 3300042610 | Bacteria | 1146 |
| 97 | Ga0466690_347468 | 3300042590 | Bacteria | 4189 |
| 98 | Ga0466696_155559 | 3300042596 | Bacteria | 1569 |
| 99 | Ga0466696_301915 | 3300042596 | Unclassified | 2189 |
| 100 | Ga0466699_141425 | 3300042597 | Bacteria | 1066 |
| 101 | Ga0123355_10481776 | 3300009826 | Bacteria | 1543 |
| 102 | Ga0123356_11289674 | 3300010049 | Bacteria | 894 |
| 103 | Ga0123356_12238034 | 3300010049 | Bacteria | 683 |
| 104 | Ga0123353_10272693 | 3300010167 | Unclassified | 2605 |
| 105 | IMNBL1DRAFT_c0007879 | 3300000062 | Bacteria | 5517 |
| 106 | JGI24702J35022_10002248 | 3300002462 | Bacteria | 11866 |
| 107 | JGI24702J35022_10208014 | 3300002462 | Unclassified | 1122 |
| 108 | JGI24705J35276_12231578 | 3300002504 | Bacteria | 3987 |
| 109 | Ga0466710_316084 | 3300042613 | Bacteria | 1652 |
| 110 | Ga0466711_190990 | 3300042615 | Bacteria | 24298 |
| 111 | Ga0466711_335669 | 3300042615 | Bacteria | 37569 |
| 112 | Ga0466715_009739 | 3300042616 | Bacteria | 69251 |
| 113 | Ga0466728_007578 | 3300042620 | Bacteria | 2508 |
| 114 | Ga0466728_468155 | 3300042620 | Bacteria | 1508 |
| 115 | Ga0466705_088250 | 3300042612 | Bacteria | 15152 |
| 116 | Ga0466704_586174 | 3300042643 | Bacteria | 25035 |
| 117 | Ga0466709_047405 | 3300042648 | Bacteria | 4892 |
| 118 | Ga0466716_159342 | 3300042605 | Bacteria | 3024 |
| 119 | Ga0466719_245768 | 3300042606 | Bacteria | 1498 |
| 120 | Ga0466719_259708 | 3300042606 | Bacteria | 13010 |
| 121 | Ga0160460_100002 | 3300012845 | Bacteria | 833437 |
| 122 | Ga0466657_008238 | 3300042582 | Bacteria | 2647 |
| 123 | Ga0466690_036055 | 3300042590 | Bacteria | 9031 |
| 124 | Ga0466690_223746 | 3300042590 | Bacteria | 3148 |
| 125 | Ga0466693_295769 | 3300042592 | Bacteria | 1262 |
| 126 | Ga0123355_10002918 | 3300009826 | Bacteria | 24295 |
| 127 | Ga0123356_10173107 | 3300010049 | Bacteria | 2172 |
| 128 | Ga0123356_11356893 | 3300010049 | Bacteria | 873 |
| 129 | Ga0123353_11412428 | 3300010167 | Bacteria | 894 |
| 130 | Ga0123354_10351417 | 3300010882 | Bacteria | 1313 |
| 131 | JGI24696J40584_12958387 | 3300002834 | Bacteria | 4095 |
| 132 | Ga0466723_085607 | 3300042618 | Bacteria | 23658 |
| 133 | Ga0466705_178231 | 3300042612 | Bacteria | 47995 |
| 134 | Ga0466732_006487 | 3300042656 | Bacteria | 4225 |
| 135 | Ga0466732_273953 | 3300042656 | Bacteria | 1961 |
| 136 | Ga0466734_110183 | 3300042623 | Bacteria | 1815 |
| 137 | Ga0466735_072352 | 3300042624 | Bacteria | 1169 |
| 138 | Ga0466735_213617 | 3300042624 | Bacteria | 1101 |
| 139 | Ga0466703_022106 | 3300042636 | Bacteria | 4426 |
| 140 | Ga0466704_023062 | 3300042643 | Bacteria | 1234 |
| 141 | Ga0466708_176752 | 3300042652 | Bacteria | 26441 |
| 142 | Ga0466701_045106 | 3300042598 | Bacteria | 1079 |
| 143 | Ga0466716_017246 | 3300042605 | Bacteria | 3723 |
| 144 | Ga0466716_295761 | 3300042605 | Bacteria | 10101 |
| 145 | Ga0255786_1021573 | 3300022815 | Bacteria | 1166 |
| 146 | Ga0466656_338826 | 3300042550 | Bacteria | 3045 |
| 147 | Ga0466696_207603 | 3300042596 | Bacteria | 8687 |
| 148 | Ga0123356_10313642 | 3300010049 | Bacteria | 1678 |
| 149 | Ga0123356_11048384 | 3300010049 | Bacteria | 985 |
| 150 | Ga0123353_10329539 | 3300010167 | Bacteria | 2312 |
| 151 | Ga0123353_10775428 | 3300010167 | Unclassified | 1329 |
| 152 | Ga0123354_10129525 | 3300010882 | Bacteria | 3196 |
| 153 | JGI24702J35022_10366445 | 3300002462 | Bacteria | 864 |
| 154 | Ga0072941_1160853 | 3300005201 | Bacteria | 5230 |
| 155 | Ga0466711_150539 | 3300042615 | Bacteria | 27789 |
| 156 | Ga0466728_080811 | 3300042620 | Bacteria | 17781 |
| 157 | Ga0466728_448813 | 3300042620 | Bacteria | 5858 |
| 158 | Ga0466705_164121 | 3300042612 | Bacteria | 25201 |
| 159 | Ga0466732_116173 | 3300042656 | Bacteria | 1444 |
| 160 | Ga0466733_066373 | 3300042659 | Bacteria | 26399 |
| 161 | Ga0466731_042453 | 3300042622 | Bacteria | 1573 |
| 162 | Ga0466734_001602 | 3300042623 | Bacteria | 1561 |
| 163 | Ga0466735_142848 | 3300042624 | Bacteria | 5114 |
| 164 | Ga0466709_029442 | 3300042648 | Bacteria | 27734 |
| 165 | Ga0466708_413340 | 3300042652 | Bacteria | 4708 |
| 166 | Ga0466714_133845 | 3300042603 | Bacteria | 1111 |
| 167 | Ga0466697_054819 | 3300042611 | Bacteria | 3425 |
| 168 | Ga0466691_120491 | 3300042593 | Bacteria | 9658 |
| 169 | Ga0466691_120716 | 3300042593 | Bacteria | 76920 |
| 170 | Ga0466694_164645 | 3300042594 | Bacteria | 1350 |
| 171 | Ga0123356_10207576 | 3300010049 | Bacteria | 2004 |
| 172 | Ga0123356_11487403 | 3300010049 | Bacteria | 835 |
| 173 | Ga0123354_10040142 | 3300010882 | Bacteria | 7245 |
| 174 | Ga0123354_10268654 | 3300010882 | Bacteria | 1684 |
| 175 | JGI24696J40584_12834400 | 3300002834 | Unclassified | 938 |
| 176 | Ga0466710_265955 | 3300042613 | Bacteria | 2548 |
| 177 | Ga0466715_219957 | 3300042616 | Bacteria | 1277 |
| 178 | Ga0466726_144061 | 3300042619 | Bacteria | 6317 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.