Protein Family IF02650
Metagenome
Isolate
341
Members
120
Samples
277
Scaffolds
299.38
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10002207|Ga0123356_1000220711
- Length
- 333 aa
- Sequence
- MLLCTVGKTVKDSKDSKRQQHWACVLGLCLMGGKQVAKIVECIPNFSEGRDAESIGELVSVAKSVPGVSLLDFSSDVNHNRSVFTLIGDPAGIAEAAYQLCKKASELIDMTKQKGEHPRMGATDVIPFVPIKGVSIEECVEISKQVARRIWEGLKIPSFLYEYSAAAPGRRNLADVRKGEFEGMPEKLKLKQWAPDFGESIIHPTAGITAIGARPPLIAFNINLDTPDIEIAKAIAKKIRGSSGGLKYCKAIGIKLENRNIAQVSMNLVNSEKTPIYEVFEAVKHEAAAFGVSVTGSELIGLASSKALIDCAEFYLKIEDFDYNKQVLENHL*
Sample Types
Isolate
18.8%
Metagenome
81.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
27.1%
Blattidae
26.3%
Termitidae
24.6%
Kalotermitidae
11.0%
Rhinotermitidae
4.2%
Termopsidae
2.5%
Passalidae
1.7%
Hydrophilidae
0.8%
Stratiomyidae
0.8%
Hodotermitidae
0.8%
Taxonomy
Archaea
0
Bacteria
328
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 2 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 3 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 4 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 5 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 6 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 7 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 12 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 13 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 14 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 15 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 16 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 17 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 18 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 19 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 20 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 27 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 28 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 29 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 30 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 31 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 32 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 2820459456 | Unclassified Firmicutes Lab288P3bin148 | Isolate | Unclassified |
| 35 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 38 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 39 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 40 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 41 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 42 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 43 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 44 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 45 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 48 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 49 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 50 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 55 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 56 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 57 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 58 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 59 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 60 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 61 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 62 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 63 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 64 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 65 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 66 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 67 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 68 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 69 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 70 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 71 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 72 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 73 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 74 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 75 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 76 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 77 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 78 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 79 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 80 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 81 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 82 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 83 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 84 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 85 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 86 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 87 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 88 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 89 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 90 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 91 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 92 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 93 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 94 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 95 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 96 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 97 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 98 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 99 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 100 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 101 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 102 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 103 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 104 | 2820441105 | Unclassified Firmicutes Lab288P3bin202 | Isolate | Unclassified |
| 105 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 106 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 107 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 108 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 109 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 110 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 111 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 112 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 113 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 114 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 115 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 116 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 117 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 118 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 119 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 120 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466729_315001 | 3300042621 | Unclassified | 1710 |
| 2 | Ga0466704_594340 | 3300042643 | Bacteria | 2348 |
| 3 | Ga0466709_074792 | 3300042648 | Bacteria | 46178 |
| 4 | Ga0466725_181096 | 3300042654 | Bacteria | 9862 |
| 5 | Ga0466695_346326 | 3300042595 | Bacteria | 5342 |
| 6 | Ga0466696_001065 | 3300042596 | Bacteria | 27233 |
| 7 | Ga0466706_105693 | 3300042599 | Bacteria | 4407 |
| 8 | Ga0466706_189055 | 3300042599 | Bacteria | 12629 |
| 9 | Ga0466707_111637 | 3300042601 | Bacteria | 2768 |
| 10 | Ga0466707_142974 | 3300042601 | Bacteria | 2653 |
| 11 | Ga0466707_389396 | 3300042601 | Bacteria | 7097 |
| 12 | Ga0466714_024792 | 3300042603 | Bacteria | 1280 |
| 13 | Ga0466716_063626 | 3300042605 | Bacteria | 8898 |
| 14 | Ga0466715_215550 | 3300042616 | Bacteria | 10237 |
| 15 | IMNBL1DRAFT_c0021101 | 3300000062 | Bacteria | 2616 |
| 16 | JGI24695J34938_10000226 | 3300002450 | Bacteria | 53266 |
| 17 | Ga0123355_10005274 | 3300009826 | Bacteria | 18881 |
| 18 | Ga0123355_10060127 | 3300009826 | Bacteria | 6136 |
| 19 | Ga0123356_10019281 | 3300010049 | Bacteria | 6467 |
| 20 | Ga0123356_10238688 | 3300010049 | Bacteria | 1887 |
| 21 | Ga0123356_10480530 | 3300010049 | Bacteria | 1395 |
| 22 | Ga0123353_10328313 | 3300010167 | Bacteria | 2317 |
| 23 | Ga0123353_10559473 | 3300010167 | Bacteria | 1647 |
| 24 | Ga0123353_11050981 | 3300010167 | Bacteria | 1088 |
| 25 | Ga0123354_10011983 | 3300010882 | Bacteria | 13429 |
| 26 | Ga0123354_10409504 | 3300010882 | Bacteria | 1139 |
| 27 | Ga0466697_182787 | 3300042611 | Bacteria | 1277 |
| 28 | Ga0466705_096447 | 3300042612 | Bacteria | 32294 |
| 29 | Ga0466705_235976 | 3300042612 | Bacteria | 2080 |
| 30 | Ga0466705_265574 | 3300042612 | Bacteria | 1283 |
| 31 | Ga0466732_105550 | 3300042656 | Bacteria | 3889 |
| 32 | Ga0466729_244133 | 3300042621 | Bacteria | 1207 |
| 33 | Ga0466731_095919 | 3300042622 | Bacteria | 1589 |
| 34 | Ga0466734_014640 | 3300042623 | Bacteria | 1629 |
| 35 | Ga0466703_055982 | 3300042636 | Bacteria | 16155 |
| 36 | Ga0466703_219704 | 3300042636 | Bacteria | 4903 |
| 37 | Ga0466704_091921 | 3300042643 | Bacteria | 5102 |
| 38 | Ga0466656_367063 | 3300042550 | Bacteria | 2159 |
| 39 | Ga0466657_297930 | 3300042582 | Bacteria | 3732 |
| 40 | Ga0466690_323305 | 3300042590 | Bacteria | 15425 |
| 41 | Ga0466694_083052 | 3300042594 | Bacteria | 2083 |
| 42 | Ga0466694_226894 | 3300042594 | Bacteria | 33377 |
| 43 | Ga0466706_091181 | 3300042599 | Bacteria | 2491 |
| 44 | Ga0466707_144970 | 3300042601 | Bacteria | 107655 |
| 45 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 46 | Ga0466714_000743 | 3300042603 | Bacteria | 1784 |
| 47 | Ga0466722_153298 | 3300042609 | Bacteria | 32266 |
| 48 | Ga0466726_434408 | 3300042619 | Unclassified | 1496 |
| 49 | IMNBL1DRAFT_c0005376 | 3300000062 | Bacteria | 7341 |
| 50 | JGI24702J35022_10123478 | 3300002462 | Bacteria | 1432 |
| 51 | Ga0123355_10000206 | 3300009826 | Bacteria | 73529 |
| 52 | Ga0123355_10465389 | 3300009826 | Bacteria | 1584 |
| 53 | Ga0123356_10046973 | 3300010049 | Bacteria | 4017 |
| 54 | Ga0123356_10065314 | 3300010049 | Bacteria | 3404 |
| 55 | Ga0123356_10086419 | 3300010049 | Bacteria | 2977 |
| 56 | Ga0123356_10095283 | 3300010049 | Bacteria | 2845 |
| 57 | Ga0123353_10000580 | 3300010167 | Bacteria | 44761 |
| 58 | Ga0123353_10139209 | 3300010167 | Bacteria | 3890 |
| 59 | Ga0123354_10002881 | 3300010882 | Bacteria | 23311 |
| 60 | Ga0123354_10014608 | 3300010882 | Bacteria | 12236 |
| 61 | Ga0123354_10197328 | 3300010882 | Bacteria | 2228 |
| 62 | Ga0466705_040645 | 3300042612 | Bacteria | 6050 |
| 63 | Ga0466733_131285 | 3300042659 | Bacteria | 10556 |
| 64 | Ga0466730_011966 | 3300042625 | Bacteria | 1291 |
| 65 | Ga0466703_296108 | 3300042636 | Bacteria | 6430 |
| 66 | Ga0466704_039440 | 3300042643 | Bacteria | 4197 |
| 67 | Ga0466704_068494 | 3300042643 | Bacteria | 4849 |
| 68 | Ga0466704_534492 | 3300042643 | Bacteria | 2151 |
| 69 | Ga0466727_081946 | 3300042655 | Bacteria | 4526 |
| 70 | Ga0466690_421471 | 3300042590 | Bacteria | 34577 |
| 71 | Ga0466696_143533 | 3300042596 | Bacteria | 2685 |
| 72 | Ga0466701_056175 | 3300042598 | Bacteria | 61782 |
| 73 | Ga0466701_070840 | 3300042598 | Bacteria | 15102 |
| 74 | Ga0466700_249204 | 3300042600 | Bacteria | 41013 |
| 75 | Ga0466707_046662 | 3300042601 | Bacteria | 5918 |
| 76 | Ga0466707_223030 | 3300042601 | Bacteria | 3349 |
| 77 | Ga0466713_140837 | 3300042602 | Bacteria | 175760 |
| 78 | Ga0466715_405663 | 3300042616 | Bacteria | 18925 |
| 79 | Ga0466715_463363 | 3300042616 | Bacteria | 10172 |
| 80 | 2227568806 | 2225789004 | Bacteria | 2637 |
| 81 | 2227604343 | 2225789004 | Bacteria | 2311 |
| 82 | IMNBL1DRAFT_c0001444 | 3300000062 | Bacteria | 17765 |
| 83 | JGI24702J35022_10168670 | 3300002462 | Bacteria | 1237 |
| 84 | JGI24705J35276_12238515 | 3300002504 | Bacteria | 24729 |
| 85 | Ga0123357_10011388 | 3300009784 | Bacteria | 11399 |
| 86 | Ga0123357_10124879 | 3300009784 | Bacteria | 3228 |
| 87 | Ga0123355_10000160 | 3300009826 | Bacteria | 81965 |
| 88 | Ga0123355_10459203 | 3300009826 | Bacteria | 1599 |
| 89 | Ga0123356_10156984 | 3300010049 | Bacteria | 2267 |
| 90 | Ga0123356_10203598 | 3300010049 | Bacteria | 2021 |
| 91 | Ga0123356_10574464 | 3300010049 | Bacteria | 1290 |
| 92 | Ga0123353_10438198 | 3300010167 | Bacteria | 1929 |
| 93 | Ga0123353_10445314 | 3300010167 | Bacteria | 1909 |
| 94 | Ga0123353_10695515 | 3300010167 | Bacteria | 1428 |
| 95 | Ga0123353_10943487 | 3300010167 | Bacteria | 1168 |
| 96 | Ga0123354_10138977 | 3300010882 | Bacteria | 3018 |
| 97 | Ga0466735_040029 | 3300042624 | Bacteria | 4754 |
| 98 | Ga0466730_003905 | 3300042625 | Unclassified | 4328 |
| 99 | Ga0466703_149819 | 3300042636 | Bacteria | 2785 |
| 100 | Ga0466703_269826 | 3300042636 | Bacteria | 13640 |
| 101 | Ga0466704_260868 | 3300042643 | Bacteria | 18144 |
| 102 | Ga0466727_078492 | 3300042655 | Bacteria | 66886 |
| 103 | Ga0466657_044125 | 3300042582 | Bacteria | 1836 |
| 104 | Ga0466693_010539 | 3300042592 | Bacteria | 5654 |
| 105 | Ga0466691_040589 | 3300042593 | Bacteria | 10563 |
| 106 | Ga0466694_009682 | 3300042594 | Bacteria | 2595 |
| 107 | Ga0466694_130211 | 3300042594 | Bacteria | 1131 |
| 108 | Ga0466694_298845 | 3300042594 | Bacteria | 1659 |
| 109 | Ga0466706_021793 | 3300042599 | Bacteria | 32385 |
| 110 | Ga0466706_072433 | 3300042599 | Bacteria | 2208 |
| 111 | Ga0466706_145412 | 3300042599 | Bacteria | 15301 |
| 112 | Ga0466707_070640 | 3300042601 | Bacteria | 10499 |
| 113 | Ga0466707_112918 | 3300042601 | Bacteria | 2132 |
| 114 | Ga0466717_074858 | 3300042604 | Bacteria | 2674 |
| 115 | Ga0466719_486938 | 3300042606 | Bacteria | 2311 |
| 116 | Ga0466722_214515 | 3300042609 | Bacteria | 3805 |
| 117 | JGI24695J34938_10007190 | 3300002450 | Bacteria | 6560 |
| 118 | JGI24695J34938_10034048 | 3300002450 | Bacteria | 2339 |
| 119 | JGI24699J35502_11130845 | 3300002509 | Bacteria | 5314 |
| 120 | Ga0068305_10003312 | 3300005083 | Bacteria | 66359 |
| 121 | Ga0123357_10141376 | 3300009784 | Unclassified | 2957 |
| 122 | Ga0123355_10001168 | 3300009826 | Bacteria | 36399 |
| 123 | Ga0123355_10014073 | 3300009826 | Bacteria | 12483 |
| 124 | Ga0123355_10027604 | 3300009826 | Bacteria | 9168 |
| 125 | Ga0123355_10057081 | 3300009826 | Bacteria | 6318 |
| 126 | Ga0123355_10093412 | 3300009826 | Unclassified | 4762 |
| 127 | Ga0123356_10000110 | 3300010049 | Bacteria | 87380 |
| 128 | Ga0123356_10007275 | 3300010049 | Bacteria | 11053 |
| 129 | Ga0123356_10007898 | 3300010049 | Bacteria | 10591 |
| 130 | Ga0123353_10000299 | 3300010167 | Bacteria | 61883 |
| 131 | Ga0123353_10479150 | 3300010167 | Bacteria | 1821 |
| 132 | Ga0466705_364119 | 3300042612 | Bacteria | 4328 |
| 133 | Ga0466733_158157 | 3300042659 | Bacteria | 7961 |
| 134 | Ga0466734_154165 | 3300042623 | Bacteria | 1407 |
| 135 | Ga0466735_173251 | 3300042624 | Unclassified | 12597 |
| 136 | Ga0466703_100978 | 3300042636 | Unclassified | 1527 |
| 137 | Ga0466724_63228 | 3300042649 | Bacteria | 3841 |
| 138 | Ga0265387_1004575 | 3300024582 | Bacteria | 1881 |
| 139 | Ga0466690_069519 | 3300042590 | Bacteria | 2905 |
| 140 | Ga0466691_134747 | 3300042593 | Bacteria | 13916 |
| 141 | Ga0466695_157268 | 3300042595 | Bacteria | 6226 |
| 142 | Ga0466716_505221 | 3300042605 | Bacteria | 8513 |
| 143 | Ga0466719_212696 | 3300042606 | Bacteria | 13138 |
| 144 | Ga0466719_296981 | 3300042606 | Bacteria | 2167 |
| 145 | Ga0466719_498699 | 3300042606 | Bacteria | 3126 |
| 146 | Ga0466726_164026 | 3300042619 | Bacteria | 16878 |
| 147 | Ga0466728_354350 | 3300042620 | Bacteria | 6950 |
| 148 | IMNBL1DRAFT_c0004848 | 3300000062 | Bacteria | 7921 |
| 149 | JGI24695J34938_10001010 | 3300002450 | Bacteria | 25521 |
| 150 | Ga0072941_1376860 | 3300005201 | Bacteria | 1856 |
| 151 | Ga0123356_10000209 | 3300010049 | Bacteria | 68089 |
| 152 | Ga0123356_10002207 | 3300010049 | Bacteria | 20947 |
| 153 | Ga0123356_10349518 | 3300010049 | Bacteria | 1602 |
| 154 | Ga0123353_10086317 | 3300010167 | Bacteria | 5053 |
| 155 | Ga0123353_10100057 | 3300010167 | Bacteria | 4672 |
| 156 | Ga0123353_10235461 | 3300010167 | Bacteria | 2850 |
| 157 | Ga0123353_10417960 | 3300010167 | Bacteria | 1988 |
| 158 | Ga0123353_10507634 | 3300010167 | Bacteria | 1754 |
| 159 | Ga0123354_10137524 | 3300010882 | Bacteria | 3044 |
| 160 | Ga0123354_10315948 | 3300010882 | Bacteria | 1450 |
| 161 | Ga0466705_224620 | 3300042612 | Bacteria | 12074 |
| 162 | Ga0466705_275413 | 3300042612 | Bacteria | 2001 |
| 163 | Ga0466732_027255 | 3300042656 | Bacteria | 10166 |
| 164 | Ga0466733_035306 | 3300042659 | Bacteria | 102874 |
| 165 | Ga0466735_224192 | 3300042624 | Bacteria | 3054 |
| 166 | Ga0466703_116313 | 3300042636 | Unclassified | 3083 |
| 167 | Ga0466703_136440 | 3300042636 | Bacteria | 4584 |
| 168 | Ga0466704_204586 | 3300042643 | Bacteria | 5602 |
| 169 | Ga0466708_086491 | 3300042652 | Bacteria | 11364 |
| 170 | Ga0466727_260621 | 3300042655 | Bacteria | 5744 |
| 171 | Ga0466727_325585 | 3300042655 | Bacteria | 1936 |
| 172 | Ga0466692_152545 | 3300042591 | Bacteria | 10387 |
| 173 | Ga0466694_076859 | 3300042594 | Bacteria | 5057 |
| 174 | Ga0466694_233927 | 3300042594 | Bacteria | 2885 |
| 175 | Ga0466696_040543 | 3300042596 | Bacteria | 2923 |
| 176 | Ga0466696_097061 | 3300042596 | Bacteria | 11024 |
| 177 | Ga0466696_151110 | 3300042596 | Bacteria | 63406 |
| 178 | Ga0466696_295663 | 3300042596 | Bacteria | 20617 |
| 179 | Ga0466701_033474 | 3300042598 | Bacteria | 1647 |
| 180 | Ga0466700_258871 | 3300042600 | Bacteria | 4090 |
| 181 | Ga0466700_276832 | 3300042600 | Bacteria | 2690 |
| 182 | Ga0466707_076457 | 3300042601 | Bacteria | 1480 |
| 183 | Ga0466707_277072 | 3300042601 | Bacteria | 28806 |
| 184 | Ga0466713_061855 | 3300042602 | Bacteria | 19591 |
| 185 | Ga0466713_097936 | 3300042602 | Bacteria | 32193 |
| 186 | Ga0466714_151048 | 3300042603 | Bacteria | 1118 |
| 187 | Ga0466719_474629 | 3300042606 | Bacteria | 8550 |
| 188 | Ga0466722_049008 | 3300042609 | Bacteria | 7945 |
| 189 | Ga0466698_174124 | 3300042610 | Bacteria | 1632 |
| 190 | Ga0466715_054883 | 3300042616 | Bacteria | 8196 |
| 191 | Ga0466715_129193 | 3300042616 | Unclassified | 14521 |
| 192 | Ga0466723_329002 | 3300042618 | Bacteria | 8595 |
| 193 | 2227245539 | 2225789004 | Unclassified | 1330 |
| 194 | IMNBL1DRAFT_c0000872 | 3300000062 | Bacteria | 23525 |
| 195 | IMNBL1DRAFT_c0001464 | 3300000062 | Bacteria | 17646 |
| 196 | JGI24702J35022_10000615 | 3300002462 | Bacteria | 21682 |
| 197 | JGI24702J35022_10006442 | 3300002462 | Bacteria | 6787 |
| 198 | JGI24702J35022_10209489 | 3300002462 | Bacteria | 1119 |
| 199 | Ga0123357_10039029 | 3300009784 | Unclassified | 6466 |
| 200 | Ga0123357_10115997 | 3300009784 | Bacteria | 3393 |
| 201 | Ga0123355_10008553 | 3300009826 | Bacteria | 15461 |
| 202 | Ga0123355_10084430 | 3300009826 | Bacteria | 5056 |
| 203 | Ga0123355_10210451 | 3300009826 | Bacteria | 2819 |
| 204 | Ga0123356_10012094 | 3300010049 | Bacteria | 8392 |
| 205 | Ga0123356_10265033 | 3300010049 | Bacteria | 1804 |
| 206 | Ga0123356_10325904 | 3300010049 | Bacteria | 1651 |
| 207 | Ga0123356_10392297 | 3300010049 | Bacteria | 1523 |
| 208 | Ga0123353_10058264 | 3300010167 | Bacteria | 6188 |
| 209 | Ga0123354_10169839 | 3300010882 | Bacteria | 2544 |
| 210 | Ga0466705_329945 | 3300042612 | Bacteria | 16071 |
| 211 | Ga0466729_217511 | 3300042621 | Bacteria | 24173 |
| 212 | Ga0466729_299782 | 3300042621 | Bacteria | 7596 |
| 213 | Ga0466735_038465 | 3300042624 | Bacteria | 6890 |
| 214 | Ga0466704_074055 | 3300042643 | Bacteria | 16245 |
| 215 | Ga0466704_099494 | 3300042643 | Bacteria | 26904 |
| 216 | Ga0466709_176307 | 3300042648 | Bacteria | 46103 |
| 217 | Ga0466709_418555 | 3300042648 | Bacteria | 7018 |
| 218 | Ga0415639_006424 | 3300038395 | Bacteria | 1611 |
| 219 | Ga0466692_023855 | 3300042591 | Bacteria | 10791 |
| 220 | Ga0466693_005642 | 3300042592 | Bacteria | 4667 |
| 221 | Ga0466694_157260 | 3300042594 | Bacteria | 2325 |
| 222 | Ga0466696_001395 | 3300042596 | Bacteria | 3355 |
| 223 | Ga0466713_101286 | 3300042602 | Bacteria | 33344 |
| 224 | Ga0466719_571613 | 3300042606 | Bacteria | 1855 |
| 225 | Ga0466722_160331 | 3300042609 | Bacteria | 3054 |
| 226 | Ga0466723_013154 | 3300042618 | Bacteria | 95841 |
| 227 | Ga0466723_335396 | 3300042618 | Bacteria | 8081 |
| 228 | Ga0466723_355141 | 3300042618 | Bacteria | 11770 |
| 229 | Ga0466726_079750 | 3300042619 | Bacteria | 1836 |
| 230 | IMNBL1DRAFT_c0002821 | 3300000062 | Bacteria | 11720 |
| 231 | JGI24695J34938_10000454 | 3300002450 | Bacteria | 39782 |
| 232 | JGI24702J35022_10061277 | 3300002462 | Bacteria | 2012 |
| 233 | JGI24702J35022_10097844 | 3300002462 | Bacteria | 1603 |
| 234 | JGI24700J35501_10925831 | 3300002508 | Bacteria | 5970 |
| 235 | JGI24699J35502_11134196 | 3300002509 | Bacteria | 51872 |
| 236 | JGI24699J35502_11134223 | 3300002509 | Bacteria | 71514 |
| 237 | Ga0123355_10111865 | 3300009826 | Unclassified | 4264 |
| 238 | Ga0123356_10000636 | 3300010049 | Bacteria | 38737 |
| 239 | Ga0123356_10055586 | 3300010049 | Bacteria | 3687 |
| 240 | Ga0123356_10121755 | 3300010049 | Unclassified | 2539 |
| 241 | Ga0123356_10274345 | 3300010049 | Bacteria | 1778 |
| 242 | Ga0123353_10384586 | 3300010167 | Bacteria | 2097 |
| 243 | Ga0123353_10882752 | 3300010167 | Bacteria | 1220 |
| 244 | Ga0466703_124236 | 3300042636 | Bacteria | 6665 |
| 245 | Ga0466703_355364 | 3300042636 | Bacteria | 2026 |
| 246 | Ga0466704_161427 | 3300042643 | Bacteria | 11789 |
| 247 | Ga0466724_08704 | 3300042649 | Bacteria | 34647 |
| 248 | Ga0466724_51652 | 3300042649 | Bacteria | 1376 |
| 249 | Ga0466725_011428 | 3300042654 | Bacteria | 1837 |
| 250 | Ga0466727_043474 | 3300042655 | Bacteria | 1231 |
| 251 | Ga0466690_110253 | 3300042590 | Bacteria | 30882 |
| 252 | Ga0466690_123938 | 3300042590 | Bacteria | 17302 |
| 253 | Ga0466701_061142 | 3300042598 | Bacteria | 1724 |
| 254 | Ga0466706_189871 | 3300042599 | Bacteria | 61075 |
| 255 | Ga0466706_243106 | 3300042599 | Bacteria | 6140 |
| 256 | Ga0466715_258163 | 3300042616 | Bacteria | 7734 |
| 257 | Ga0466715_337561 | 3300042616 | Bacteria | 7957 |
| 258 | Ga0466723_257054 | 3300042618 | Bacteria | 10959 |
| 259 | Ga0466728_108576 | 3300042620 | Bacteria | 2331 |
| 260 | JGI24702J35022_10054718 | 3300002462 | Bacteria | 2129 |
| 261 | JGI24705J35276_12199852 | 3300002504 | Bacteria | 1592 |
| 262 | Ga0072941_1103878 | 3300005201 | Bacteria | 1735 |
| 263 | Ga0123357_10004102 | 3300009784 | Bacteria | 16973 |
| 264 | Ga0123357_10221943 | 3300009784 | Bacteria | 2094 |
| 265 | Ga0123355_10000911 | 3300009826 | Bacteria | 40921 |
| 266 | Ga0123355_10012363 | 3300009826 | Bacteria | 13220 |
| 267 | Ga0123355_10038189 | 3300009826 | Bacteria | 7808 |
| 268 | Ga0123356_10099434 | 3300010049 | Bacteria | 2788 |
| 269 | Ga0123356_10125172 | 3300010049 | Bacteria | 2508 |
| 270 | Ga0123356_10310824 | 3300010049 | Bacteria | 1685 |
| 271 | Ga0123353_10018410 | 3300010167 | Bacteria | 10328 |
| 272 | Ga0123353_10048223 | 3300010167 | Bacteria | 6780 |
| 273 | Ga0123353_10126592 | 3300010167 | Bacteria | 4105 |
| 274 | Ga0123353_10619929 | 3300010167 | Bacteria | 1540 |
| 275 | Ga0123353_10727320 | 3300010167 | Bacteria | 1387 |
| 276 | Ga0123353_10738980 | 3300010167 | Bacteria | 1372 |
| 277 | Ga0123353_10940900 | 3300010167 | Bacteria | 1170 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.