Protein Family IF02602
Metagenome
Isolate
152
Members
55
Samples
150
Scaffolds
117.51
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_11631122|Ga0123355_116311221
- Length
- 122 aa
- Sequence
- MDFAYFWVVLLAAVFLVVAGISLALWLAPRSDNPQKREAYECGIPTRGTSWMQFKVGYYLFAILYIMFDVGTVFLFPWATVAKREEDGGLGFPGFIGMLFFLMMLALGLAYAWRKGALKWK*
Sample Types
Isolate
1.3%
Metagenome
98.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.3%
Kalotermitidae
24.5%
Unclassified
9.4%
Termopsidae
7.5%
Rhinotermitidae
5.7%
Passalidae
3.8%
Hodotermitidae
1.9%
Kiwaidae
1.9%
Taxonomy
Archaea
0
Bacteria
144
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 8 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 38 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 39 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 53 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 54 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 55 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_199652 | 3300042611 | Bacteria | 1075 |
| 2 | Ga0466697_214606 | 3300042611 | Bacteria | 2711 |
| 3 | Ga0466705_051958 | 3300042612 | Bacteria | 7798 |
| 4 | Ga0123357_10800864 | 3300009784 | Bacteria | 638 |
| 5 | Ga0123355_11631122 | 3300009826 | Bacteria | 619 |
| 6 | Ga0466656_036973 | 3300042550 | Bacteria | 1004 |
| 7 | JGI24699J35502_11132626 | 3300002509 | Bacteria | 7233 |
| 8 | Ga0466700_308359 | 3300042600 | Bacteria | 2181 |
| 9 | Ga0466716_018151 | 3300042605 | Bacteria | 4963 |
| 10 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 11 | Ga0466722_151543 | 3300042609 | Bacteria | 3644 |
| 12 | Ga0466703_148593 | 3300042636 | Bacteria | 3291 |
| 13 | Ga0466704_082750 | 3300042643 | Bacteria | 26962 |
| 14 | Ga0466724_38873 | 3300042649 | Unclassified | 1253 |
| 15 | Ga0466710_410871 | 3300042613 | Bacteria | 1903 |
| 16 | Ga0466711_207811 | 3300042615 | Bacteria | 2195 |
| 17 | Ga0123356_10325119 | 3300010049 | Bacteria | 1652 |
| 18 | Ga0123356_12647724 | 3300010049 | Bacteria | 628 |
| 19 | Ga0123356_13031774 | 3300010049 | Bacteria | 586 |
| 20 | Ga0123353_10985630 | 3300010167 | Bacteria | 1135 |
| 21 | Ga0123354_10218920 | 3300010882 | Bacteria | 2030 |
| 22 | Ga0123354_10489548 | 3300010882 | Unclassified | 966 |
| 23 | Ga0466690_294371 | 3300042590 | Bacteria | 12872 |
| 24 | Ga0466695_029421 | 3300042595 | Bacteria | 1159 |
| 25 | IMNBL1DRAFT_c0045152 | 3300000062 | Bacteria | 1441 |
| 26 | Ga0068302_10060856 | 3300005071 | Bacteria | 3414 |
| 27 | Ga0068305_10132408 | 3300005083 | Bacteria | 9852 |
| 28 | Ga0466706_276356 | 3300042599 | Bacteria | 20327 |
| 29 | Ga0466713_009321 | 3300042602 | Bacteria | 6192 |
| 30 | Ga0466714_109108 | 3300042603 | Bacteria | 1869 |
| 31 | Ga0466722_237599 | 3300042609 | Bacteria | 4902 |
| 32 | Ga0466697_056731 | 3300042611 | Bacteria | 3261 |
| 33 | Ga0466735_162346 | 3300042624 | Bacteria | 1187 |
| 34 | Ga0466703_175050 | 3300042636 | Bacteria | 4825 |
| 35 | Ga0466723_219489 | 3300042618 | Bacteria | 4655 |
| 36 | Ga0466726_304941 | 3300042619 | Bacteria | 5517 |
| 37 | Ga0466728_183857 | 3300042620 | Bacteria | 4473 |
| 38 | Ga0466729_124228 | 3300042621 | Bacteria | 1294 |
| 39 | Ga0466697_280496 | 3300042611 | Bacteria | 1747 |
| 40 | Ga0123356_10781787 | 3300010049 | Bacteria | 1125 |
| 41 | Ga0123356_10905665 | 3300010049 | Bacteria | 1053 |
| 42 | Ga0123353_10789768 | 3300010167 | Bacteria | 1313 |
| 43 | Ga0123354_10000201 | 3300010882 | Bacteria | 51540 |
| 44 | Ga0466690_032916 | 3300042590 | Bacteria | 4930 |
| 45 | Ga0466690_221231 | 3300042590 | Bacteria | 12698 |
| 46 | Ga0466692_102850 | 3300042591 | Bacteria | 14012 |
| 47 | Ga0466692_191366 | 3300042591 | Bacteria | 14423 |
| 48 | Ga0466691_043814 | 3300042593 | Bacteria | 3058 |
| 49 | Ga0466696_156693 | 3300042596 | Bacteria | 3603 |
| 50 | JGI24699J35502_11134224 | 3300002509 | Bacteria | 74083 |
| 51 | JGI24696J40584_12532814 | 3300002834 | Bacteria | 616 |
| 52 | Ga0068302_10006503 | 3300005071 | Bacteria | 2440 |
| 53 | Ga0466707_419961 | 3300042601 | Bacteria | 6833 |
| 54 | Ga0466714_047986 | 3300042603 | Bacteria | 3420 |
| 55 | Ga0466722_098770 | 3300042609 | Bacteria | 9734 |
| 56 | Ga0466722_113973 | 3300042609 | Bacteria | 4184 |
| 57 | Ga0466703_140271 | 3300042636 | Bacteria | 55996 |
| 58 | Ga0466711_104987 | 3300042615 | Bacteria | 5782 |
| 59 | Ga0466715_069909 | 3300042616 | Bacteria | 7851 |
| 60 | Ga0466726_022420 | 3300042619 | Bacteria | 2763 |
| 61 | Ga0466728_409199 | 3300042620 | Bacteria | 11557 |
| 62 | Ga0466729_100878 | 3300042621 | Bacteria | 3209 |
| 63 | Ga0466697_143140 | 3300042611 | Bacteria | 1145 |
| 64 | Ga0123357_10015964 | 3300009784 | Bacteria | 9862 |
| 65 | Ga0123357_10313665 | 3300009784 | Bacteria | 1561 |
| 66 | Ga0123357_10979008 | 3300009784 | Bacteria | 530 |
| 67 | Ga0123353_10740824 | 3300010167 | Bacteria | 1370 |
| 68 | Ga0123354_10002580 | 3300010882 | Bacteria | 24135 |
| 69 | Ga0123354_10225967 | 3300010882 | Bacteria | 1972 |
| 70 | Ga0123354_10273105 | 3300010882 | Bacteria | 1659 |
| 71 | Ga0466690_149899 | 3300042590 | Bacteria | 20818 |
| 72 | IMNBL1DRAFT_c0056689 | 3300000062 | Bacteria | 1200 |
| 73 | Ga0466701_043412 | 3300042598 | Bacteria | 5724 |
| 74 | Ga0466714_000499 | 3300042603 | Bacteria | 1704 |
| 75 | Ga0466714_078601 | 3300042603 | Bacteria | 3262 |
| 76 | Ga0466721_367895 | 3300042608 | Bacteria | 1917 |
| 77 | Ga0466703_083648 | 3300042636 | Bacteria | 14677 |
| 78 | Ga0466727_167278 | 3300042655 | Bacteria | 64897 |
| 79 | Ga0466710_347634 | 3300042613 | Bacteria | 1679 |
| 80 | Ga0466711_008482 | 3300042615 | Bacteria | 9471 |
| 81 | Ga0466715_014882 | 3300042616 | Bacteria | 29632 |
| 82 | Ga0466715_240109 | 3300042616 | Bacteria | 17583 |
| 83 | Ga0123357_10520349 | 3300009784 | Bacteria | 972 |
| 84 | Ga0123356_10275034 | 3300010049 | Bacteria | 1776 |
| 85 | Ga0123356_11090222 | 3300010049 | Bacteria | 967 |
| 86 | Ga0123353_10726379 | 3300010167 | Bacteria | 1388 |
| 87 | Ga0123353_11950396 | 3300010167 | Bacteria | 722 |
| 88 | Ga0123354_10105282 | 3300010882 | Bacteria | 3776 |
| 89 | Ga0466690_102333 | 3300042590 | Bacteria | 6156 |
| 90 | 2227280251 | 2225789004 | Bacteria | 1261 |
| 91 | JGI24702J35022_10010617 | 3300002462 | Bacteria | 5143 |
| 92 | JGI24696J40584_12866686 | 3300002834 | Bacteria | 1030 |
| 93 | Ga0466706_109799 | 3300042599 | Bacteria | 205088 |
| 94 | Ga0466707_404068 | 3300042601 | Bacteria | 3494 |
| 95 | Ga0466714_167060 | 3300042603 | Bacteria | 3370 |
| 96 | Ga0466719_388414 | 3300042606 | Bacteria | 11249 |
| 97 | Ga0466734_156999 | 3300042623 | Bacteria | 3748 |
| 98 | Ga0466735_197528 | 3300042624 | Bacteria | 1658 |
| 99 | Ga0466704_019741 | 3300042643 | Bacteria | 2133 |
| 100 | Ga0466724_67226 | 3300042649 | Unclassified | 6738 |
| 101 | Ga0466725_088847 | 3300042654 | Bacteria | 1717 |
| 102 | Ga0466726_275770 | 3300042619 | Bacteria | 15891 |
| 103 | Ga0466733_037689 | 3300042659 | Bacteria | 1536 |
| 104 | Ga0466733_180918 | 3300042659 | Bacteria | 6230 |
| 105 | Ga0466733_222898 | 3300042659 | Bacteria | 1142 |
| 106 | Ga0123356_10154068 | 3300010049 | Bacteria | 2286 |
| 107 | Ga0466693_200914 | 3300042592 | Bacteria | 1095 |
| 108 | Ga0466696_151083 | 3300042596 | Bacteria | 1241 |
| 109 | Ga0466696_296242 | 3300042596 | Bacteria | 2534 |
| 110 | JGI24705J35276_11734637 | 3300002504 | Bacteria | 649 |
| 111 | Ga0072941_1099823 | 3300005201 | Bacteria | 6550 |
| 112 | Ga0466714_045521 | 3300042603 | Bacteria | 3544 |
| 113 | Ga0466716_264400 | 3300042605 | Bacteria | 2576 |
| 114 | Ga0466719_319955 | 3300042606 | Bacteria | 5163 |
| 115 | Ga0466731_156373 | 3300042622 | Bacteria | 1055 |
| 116 | Ga0466709_306736 | 3300042648 | Bacteria | 12422 |
| 117 | Ga0466710_201426 | 3300042613 | Bacteria | 1206 |
| 118 | Ga0466723_217671 | 3300042618 | Bacteria | 2952 |
| 119 | Ga0466726_160354 | 3300042619 | Bacteria | 5014 |
| 120 | Ga0466726_280553 | 3300042619 | Bacteria | 8250 |
| 121 | Ga0466729_096704 | 3300042621 | Bacteria | 15068 |
| 122 | Ga0466697_203889 | 3300042611 | Bacteria | 1384 |
| 123 | Ga0466733_060765 | 3300042659 | Bacteria | 20015 |
| 124 | Ga0466690_076351 | 3300042590 | Unclassified | 4232 |
| 125 | Ga0466694_252214 | 3300042594 | Bacteria | 1090 |
| 126 | Ga0466696_117540 | 3300042596 | Bacteria | 4651 |
| 127 | JGI24696J40584_12719331 | 3300002834 | Unclassified | 757 |
| 128 | Ga0072941_1167368 | 3300005201 | Bacteria | 1813 |
| 129 | Ga0466700_013223 | 3300042600 | Bacteria | 1184 |
| 130 | Ga0466714_109410 | 3300042603 | Bacteria | 1204 |
| 131 | Ga0466735_178283 | 3300042624 | Bacteria | 4947 |
| 132 | Ga0466703_285165 | 3300042636 | Unclassified | 2493 |
| 133 | Ga0466727_162788 | 3300042655 | Unclassified | 3777 |
| 134 | Ga0466715_038030 | 3300042616 | Bacteria | 2709 |
| 135 | Ga0123356_10877323 | 3300010049 | Bacteria | 1068 |
| 136 | Ga0123353_10386237 | 3300010167 | Bacteria | 2091 |
| 137 | Ga0123354_10992058 | 3300010882 | Bacteria | 541 |
| 138 | Ga0157631_132623 | 3300013007 | Bacteria | 786 |
| 139 | Ga0265387_1040607 | 3300024582 | Bacteria | 797 |
| 140 | Ga0466691_001313 | 3300042593 | Bacteria | 4338 |
| 141 | Ga0466691_181893 | 3300042593 | Bacteria | 10363 |
| 142 | IMNBL1DRAFT_c0006392 | 3300000062 | Bacteria | 6445 |
| 143 | JGI24705J35276_12026207 | 3300002504 | Bacteria | 881 |
| 144 | JGI24699J35502_11047045 | 3300002509 | Bacteria | 1620 |
| 145 | Ga0466707_150660 | 3300042601 | Bacteria | 1174 |
| 146 | Ga0466735_064452 | 3300042624 | Bacteria | 1315 |
| 147 | Ga0466710_105335 | 3300042613 | Bacteria | 3690 |
| 148 | Ga0466710_211018 | 3300042613 | Bacteria | 1228 |
| 149 | Ga0466711_006852 | 3300042615 | Bacteria | 65097 |
| 150 | Ga0466723_112791 | 3300042618 | Unclassified | 1560 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00507 | Oxidored_q4 | NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 | 20 | 120 | 0.95 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00507 | GO:0008137 | NADH dehydrogenase (ubiquinone) activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.