Protein Family IF02467

Metagenome Metatranscriptome Isolate
657 Members
215 Samples
500 Scaffolds
196.83 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10149533|Ga0123355_101495332
Length
238 aa
Sequence
VLKLNSRHKIFQVKISEVKRTFHENRNVFGSAGKGYRRLMTLIPYVIEQTSRGERSYDIYSRLLKDRIIFLGDAIDDQIASVVVAQLLFLEAEDSEKDISLYINSPGGSVTAGLAIYDTMQFIRPDVSTICIGMAASMGAFLLSSGAKGKRYALPNAEIMIHQPLGGVRGQAEDIRIHADHIIRTREKLNKILSDNTGQELSKIEKDTDRDTFLSADEAVSYGLVDKVFNFRGVGNV*

πŸ“Š Sample Types

Isolate 23.9%
Metagenome 76.0%
MAG 0.0%
Metatranscriptome 0.1%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 37.0%
Termitidae 17.8%
Blattidae 12.0%
Kalotermitidae 7.2%
Pyralidae 2.9%
Tenebrionidae 2.9%
Apidae 2.4%
Aphididae 1.9%
Scarabaeidae 1.9%
Rhinotermitidae 1.4%
Termopsidae 1.4%
Passalidae 1.4%
Armadillidiidae 1.4%
Argasidae 1.0%
Bombycidae 1.0%
Elmidae 1.0%
Culicidae 1.0%
Ocypodidae 0.5%
Drosophilidae 0.5%
Calliphoridae 0.5%
Hodotermitidae 0.5%
Noctuidae 0.5%
Eresidae 0.5%
Ixodidae 0.5%
Formicidae 0.5%
Curculionidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 586
Eukaryota 0
Viruses 0
Unclassified 71

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
2 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
3 8114010755 Borrelia coriaceae Co53 Isolate Argasidae
4 2558860197 Buchnera aphidicola F009 Isolate Aphididae
5 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
6 2820214248 Unclassified Kiritimatiellaeota Nt197P3bin16 Isolate Unclassified
7 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
8 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
9 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
10 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
11 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
12 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
24 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
25 3300009534 Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov Metagenome
26 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
27 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
28 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
29 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
30 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
31 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
32 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
33 2599185261 Thorsellia anophelis DSM 18579 Isolate Unclassified
34 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
35 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
36 2820023741 Unclassified Spirochaetes Lab288P3bin165 Isolate Unclassified
37 2820106212 Unclassified Proteobacteria Emb289P4bin44 Isolate Unclassified
38 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
39 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
40 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
41 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
42 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
43 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
44 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
45 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
48 8012112996 Staphylococcus muscae ATCC 49910 Isolate
49 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
50 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
51 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
52 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
53 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
54 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
55 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
56 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
57 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
58 2978778678 Bacillus cereus 25 Isolate Ocypodidae
59 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
60 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
61 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
62 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
63 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
64 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
65 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
66 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
67 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
68 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
69 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
70 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
71 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
72 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
73 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
74 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
75 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
76 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
77 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
78 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
79 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
80 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
81 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
82 2837615801 Gilliamella apicola ESL0177 Isolate Apidae
83 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
84 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
85 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
86 2537562000 Bacillus cereus HD73 Isolate Pyralidae
87 2558860196 Buchnera aphidicola W106 Isolate Aphididae
88 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
89 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
90 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
91 2820127165 Unclassified Proteobacteria Emb289P3bin90 Isolate Unclassified
92 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
93 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
94 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
95 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
96 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
97 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
98 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
99 2687453757 Opitutus sp. Cag34 Isolate Unclassified
100 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
101 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
102 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
103 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
104 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
105 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
106 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
107 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
108 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
109 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
110 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
111 2828505942 Spirobacillus cienkowskii binning01 Isolate Unclassified
112 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
113 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
114 2876019154 Gilliamella apicola ESL0182 Isolate Apidae
115 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
116 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
117 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
118 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
119 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
120 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
121 2558860195 Buchnera aphidicola G002 Isolate Aphididae
122 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
123 2684622926 Gilliamella apicola Ga_182 Isolate Unclassified
124 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
125 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
126 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
127 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
128 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
129 2772190890 Unclassified Elusimicrobia Lab288P4_bin46 Isolate Unclassified
130 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
131 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
132 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
133 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
134 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
135 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
136 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
137 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
138 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
139 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
140 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
141 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
142 3300000473 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 Metagenome Apidae
143 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
144 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
145 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
146 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
147 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
148 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
149 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
150 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
151 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
152 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
153 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
154 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
155 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
156 2820217359 Unclassified Kiritimatiellaeota Nt197P3bin101 Isolate Unclassified
157 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
158 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
159 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
160 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
161 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
162 8022725327 Bacillus sp. SN10 Isolate Eresidae
163 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
164 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
165 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
166 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
167 3002773460 Coxiella endosymbiont of Amblyomma nuttalli Craf2019 Isolate Ixodidae
168 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
169 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
170 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
171 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
172 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
173 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
174 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
175 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
176 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
177 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
178 2684622924 Gilliamella apicola Ga_177 Isolate Unclassified
179 2820025825 Unclassified Spirochaetes Lab288P1bin8 Isolate Unclassified
180 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
181 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
182 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
183 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
184 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
185 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
186 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
187 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
188 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
189 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
190 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
191 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
192 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
193 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
194 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
195 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
196 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
197 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
198 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
199 2545555866 Borrelia coriaceae ATCC 43381 Isolate Argasidae
200 2558860194 Buchnera aphidicola USDA Isolate Aphididae
201 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
202 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
203 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
204 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
205 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
206 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
207 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
208 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
209 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
210 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
211 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
212 642555127 Elusimicrobium minutum Pei191 Isolate Unclassified
213 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
214 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
215 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0530661_000321 3300056564 Bacteria 37215
2 Ga0562379_0243 3300056790 Bacteria 147751
3 Ga0562377_0006 3300056842 Bacteria 3350072
4 Ga0562374_0009 3300057007 Bacteria 1987311
5 Ga0160452_100452 3300012834 Bacteria 28393
6 Ga0160445_101045 3300012847 Bacteria 9091
7 Ga0415639_012146 3300038395 Bacteria 28657
8 Ga0415639_174407 3300038395 Bacteria 1367
9 Ga0466691_184643 3300042593 Bacteria 8633
10 Ga0466694_268349 3300042594 Bacteria 5980
11 Ga0466696_029011 3300042596 Bacteria 14065
12 Ga0466696_202868 3300042596 Bacteria 3400
13 Ga0466696_299514 3300042596 Bacteria 3186
14 Ga0466696_476173 3300042596 Bacteria 1802
15 Ga0466705_489565 3300042612 Unclassified 1351
16 Ga0466711_415567 3300042615 Bacteria 1996
17 Ga0466715_019040 3300042616 Bacteria 23578
18 Ga0466715_455706 3300042616 Bacteria 10318
19 Ga0466726_060099 3300042619 Bacteria 27221
20 Ga0466726_412415 3300042619 Bacteria 36426
21 Ga0466728_139068 3300042620 Bacteria 3702
22 Ga0466706_069745 3300042599 Bacteria 2784
23 Ga0466700_361890 3300042600 Bacteria 1281
24 Ga0466713_050652 3300042602 Bacteria 32679
25 Ga0466713_087021 3300042602 Bacteria 7337
26 Ga0466713_150486 3300042602 Bacteria 10903
27 Ga0466719_153018 3300042606 Bacteria 2757
28 Ga0466719_161292 3300042606 Bacteria 4768
29 Ga0123357_10368326 3300009784 Bacteria 1350
30 Ga0123355_10877510 3300009826 Bacteria 980
31 Ga0123356_10013568 3300010049 Bacteria 7857
32 Ga0123356_10016644 3300010049 Bacteria 7014
33 Ga0123356_10121295 3300010049 Bacteria 2543
34 Ga0123356_10519162 3300010049 Bacteria 1349
35 Ga0123356_11358737 3300010049 Bacteria 872
36 Ga0123353_10148792 3300010167 Bacteria 3741
37 Ga0123353_10204047 3300010167 Bacteria 3107
38 Ga0123353_10231790 3300010167 Bacteria 2878
39 Ga0123353_10275497 3300010167 Unclassified 2588
40 Ga0123353_10554339 3300010167 Unclassified 1657
41 Ga0123353_10643088 3300010167 Unclassified 1503
42 Ga0123353_10753849 3300010167 Bacteria 1354
43 Ga0123353_11200116 3300010167 Bacteria 996
44 Ga0123353_11593659 3300010167 Bacteria 825
45 Ga0123354_10018189 3300010882 Bacteria 11017
46 2227080788 2225789004 Bacteria 142057
47 IMNBL1DRAFT_c0000126 3300000062 Bacteria 67951
48 IMNBL1DRAFT_c0003291 3300000062 Bacteria 10516
49 JGI24702J35022_10000754 3300002462 Bacteria 19998
50 JGI24702J35022_10020834 3300002462 Bacteria 3556
51 JGI24705J35276_12191308 3300002504 Unclassified 1473
52 Ga0466705_245565 3300042612 Bacteria 16761
53 Ga0466705_264242 3300042612 Bacteria 15290
54 Ga0466729_243625 3300042621 Unclassified 1646
55 Ga0466731_142436 3300042622 Bacteria 1203
56 Ga0466730_020422 3300042625 Bacteria 6748
57 Ga0466702_227524 3300042635 Bacteria 1525
58 Ga0466703_017123 3300042636 Bacteria 35631
59 Ga0466703_077481 3300042636 Bacteria 5285
60 Ga0466703_169540 3300042636 Bacteria 10929
61 Ga0466704_107005 3300042643 Bacteria 4539
62 Ga0466704_223677 3300042643 Bacteria 60624
63 Ga0466704_336503 3300042643 Bacteria 1977
64 Ga0466709_314382 3300042648 Bacteria 1981
65 Ga0466727_033693 3300042655 Bacteria 4256
66 Ga0466727_187615 3300042655 Unclassified 14054
67 Ga0466727_189885 3300042655 Unclassified 1373
68 Ga0466727_266610 3300042655 Bacteria 57822
69 Ga0466733_034104 3300042659 Bacteria 15795
70 Ga0160455_100285 3300012837 Bacteria 34029
71 Ga0415639_000074 3300038395 Bacteria 109555
72 Ga0466690_051544 3300042590 Bacteria 1758
73 Ga0466693_369000 3300042592 Bacteria 1328
74 Ga0466691_109100 3300042593 Bacteria 46214
75 Ga0466694_245043 3300042594 Bacteria 2253
76 Ga0466696_433112 3300042596 Unclassified 6748
77 Ga0466696_440776 3300042596 Bacteria 5674
78 Ga0466696_485836 3300042596 Bacteria 1204
79 Ga0466701_008910 3300042598 Bacteria 31998
80 Ga0466705_484917 3300042612 Unclassified 2898
81 Ga0466705_506684 3300042612 Bacteria 5367
82 Ga0466710_169912 3300042613 Unclassified 1156
83 Ga0466711_150433 3300042615 Bacteria 22953
84 Ga0466711_408466 3300042615 Bacteria 6889
85 Ga0466715_406326 3300042616 Bacteria 1122
86 Ga0466723_071424 3300042618 Bacteria 8394
87 Ga0466723_247331 3300042618 Bacteria 2317
88 Ga0466723_320278 3300042618 Bacteria 4208
89 Ga0466726_034751 3300042619 Bacteria 7836
90 Ga0466726_360898 3300042619 Bacteria 2986
91 Ga0466728_010918 3300042620 Bacteria 20886
92 Ga0466706_211143 3300042599 Bacteria 3091
93 Ga0466707_042518 3300042601 Bacteria 1295
94 Ga0466707_152625 3300042601 Bacteria 2527
95 Ga0466707_189612 3300042601 Bacteria 4665
96 Ga0466707_261116 3300042601 Bacteria 4576
97 Ga0466713_089647 3300042602 Bacteria 79512
98 Ga0466716_086660 3300042605 Bacteria 5660
99 Ga0466722_132852 3300042609 Bacteria 6135
100 Ga0466722_163971 3300042609 Unclassified 1302
101 Ga0123355_10001929 3300009826 Bacteria 29177
102 Ga0123355_10111569 3300009826 Bacteria 4271
103 Ga0123355_10606064 3300009826 Bacteria 1297
104 Ga0123355_11181282 3300009826 Unclassified 784
105 Ga0123356_10058859 3300010049 Bacteria 3583
106 Ga0123356_10101900 3300010049 Unclassified 2755
107 Ga0123356_10137482 3300010049 Bacteria 2405
108 Ga0123356_10255534 3300010049 Unclassified 1832
109 Ga0123356_10300907 3300010049 Bacteria 1709
110 Ga0123353_10000407 3300010167 Bacteria 53023
111 Ga0123353_10001338 3300010167 Bacteria 30219
112 Ga0123353_10004845 3300010167 Bacteria 17484
113 Ga0123353_10114782 3300010167 Bacteria 4336
114 Ga0123353_10372391 3300010167 Bacteria 2140
115 Ga0123353_10443923 3300010167 Bacteria 1913
116 Ga0123353_10484532 3300010167 Bacteria 1808
117 Ga0123353_10607225 3300010167 Bacteria 1562
118 Ga0123353_10712620 3300010167 Bacteria 1406
119 Ga0123353_11387600 3300010167 Bacteria 904
120 Ga0123354_10000041 3300010882 Bacteria 95687
121 Ga0123354_10175741 3300010882 Bacteria 2469
122 Ga0123354_10195273 3300010882 Bacteria 2248
123 Ga0123354_10264939 3300010882 Bacteria 1706
124 IMNBL1DRAFT_c0000143 3300000062 Bacteria 63658
125 IMNBL1DRAFT_c0002208 3300000062 Bacteria 13725
126 JGI24695J34938_10013803 3300002450 Bacteria 4224
127 JGI24695J34938_10117717 3300002450 Unclassified 1081
128 JGI24700J35501_10930784 3300002508 Bacteria 23855
129 Ga0127648_100010 3300009534 Bacteria 473475
130 Ga0466705_200329 3300042612 Bacteria 3995
131 Ga0466704_431526 3300042643 Bacteria 9788
132 Ga0466709_325372 3300042648 Bacteria 1434
133 Ga0466708_249968 3300042652 Bacteria 6895
134 Ga0466725_168793 3300042654 Bacteria 1400
135 Ga0466727_141907 3300042655 Bacteria 16373
136 Ga0466733_052404 3300042659 Bacteria 4794
137 Ga0160445_101272 3300012847 Bacteria 7504
138 Ga0415639_035232 3300038395 Bacteria 1244
139 Ga0466690_179376 3300042590 Bacteria 9529
140 Ga0466690_284848 3300042590 Bacteria 2624
141 Ga0466692_101026 3300042591 Bacteria 12078
142 Ga0466696_189726 3300042596 Bacteria 6639
143 Ga0466699_145472 3300042597 Bacteria 2342
144 Ga0466711_218928 3300042615 Unclassified 4055
145 Ga0466715_463509 3300042616 Bacteria 18662
146 Ga0466723_068055 3300042618 Bacteria 2410
147 Ga0466723_116746 3300042618 Bacteria 2302
148 Ga0466723_246931 3300042618 Bacteria 2542
149 Ga0466726_023000 3300042619 Bacteria 1276
150 Ga0466726_180916 3300042619 Bacteria 14858
151 Ga0466728_237414 3300042620 Unclassified 21165
152 Ga0466728_330553 3300042620 Bacteria 29787
153 Ga0466701_021239 3300042598 Bacteria 69029
154 Ga0466706_057458 3300042599 Bacteria 9781
155 Ga0466706_131954 3300042599 Bacteria 11507
156 Ga0466706_192252 3300042599 Bacteria 2240
157 Ga0466707_208832 3300042601 Bacteria 1064
158 Ga0466714_056412 3300042603 Bacteria 39704
159 Ga0466719_067286 3300042606 Unclassified 3371
160 Ga0466722_012874 3300042609 Bacteria 7279
161 Ga0466722_129465 3300042609 Bacteria 3844
162 Ga0466698_360294 3300042610 Bacteria 6019
163 Ga0123355_10171907 3300009826 Bacteria 3236
164 Ga0123355_10189182 3300009826 Bacteria 3036
165 Ga0123356_10000758 3300010049 Bacteria 35766
166 Ga0123356_10005655 3300010049 Bacteria 12702
167 Ga0123356_10254869 3300010049 Bacteria 1835
168 Ga0123356_10469848 3300010049 Bacteria 1409
169 Ga0123353_10007405 3300010167 Bacteria 14819
170 Ga0123353_10056022 3300010167 Bacteria 6308
171 Ga0123353_10070221 3300010167 Bacteria 5627
172 Ga0123353_10224597 3300010167 Bacteria 2933
173 Ga0123353_10286203 3300010167 Bacteria 2527
174 Ga0123353_10512651 3300010167 Bacteria 1743
175 Ga0123353_10528767 3300010167 Unclassified 1708
176 Ga0123353_10676442 3300010167 Bacteria 1455
177 Ga0123353_10951448 3300010167 Unclassified 1162
178 Ga0123353_10962970 3300010167 Bacteria 1152
179 Ga0123354_10005364 3300010882 Bacteria 18606
180 2227507940 2225789004 Bacteria 76787
181 2227646814 2225789004 Bacteria 44642
182 IMNBL1DRAFT_c0061514 3300000062 Bacteria 1126
183 AustNasuHG_c1006165 3300000089 Bacteria 4285
184 JGI24702J35022_10012895 3300002462 Bacteria 4637
185 JGI24703J35330_11574538 3300002501 Bacteria 1291
186 JGI24705J35276_12055592 3300002504 Bacteria 926
187 JGI24700J35501_10928424 3300002508 Bacteria 7659
188 Ga0105005_1000898 3300007505 Bacteria 3357
189 Ga0466697_221275 3300042611 Unclassified 1997
190 Ga0466703_372296 3300042636 Unclassified 2291
191 Ga0466704_120990 3300042643 Bacteria 1704
192 Ga0466704_164735 3300042643 Bacteria 11206
193 Ga0466704_499489 3300042643 Bacteria 22078
194 Ga0466704_515801 3300042643 Bacteria 57837
195 Ga0466708_088451 3300042652 Bacteria 16438
196 Ga0466727_169466 3300042655 Unclassified 1599
197 Ga0466733_003454 3300042659 Bacteria 1369
198 Ga0466733_192497 3300042659 Bacteria 4716
199 Ga0160445_101959 3300012847 Bacteria 5168
200 Ga0415639_135453 3300038395 Bacteria 4542
201 Ga0466691_192374 3300042593 Bacteria 8491
202 Ga0466695_365332 3300042595 Bacteria 2005
203 Ga0466696_278589 3300042596 Bacteria 3554
204 Ga0466705_431149 3300042612 Bacteria 11703
205 Ga0466711_168814 3300042615 Bacteria 1569
206 Ga0466715_078576 3300042616 Bacteria 40350
207 Ga0466715_608432 3300042616 Unclassified 10557
208 Ga0466728_340391 3300042620 Bacteria 1707
209 Ga0466706_112099 3300042599 Bacteria 31681
210 Ga0466706_182209 3300042599 Unclassified 5062
211 Ga0466706_271747 3300042599 Bacteria 2960
212 Ga0466707_101581 3300042601 Bacteria 2276
213 Ga0466707_144485 3300042601 Bacteria 9320
214 Ga0466707_202459 3300042601 Bacteria 205011
215 Ga0466707_340189 3300042601 Unclassified 1547
216 Ga0466707_411886 3300042601 Unclassified 2143
217 Ga0466716_454567 3300042605 Bacteria 1418
218 Ga0466716_547684 3300042605 Bacteria 1480
219 Ga0466719_230977 3300042606 Unclassified 1679
220 Ga0466722_027922 3300042609 Bacteria 1599
221 Ga0466722_149511 3300042609 Unclassified 6061
222 Ga0466698_088026 3300042610 Bacteria 4884
223 Ga0123355_10149533 3300009826 Bacteria 3552
224 Ga0123355_10371126 3300009826 Bacteria 1874
225 Ga0123355_10371181 3300009826 Unclassified 1874
226 Ga0123355_10577462 3300009826 Bacteria 1346
227 Ga0123356_10054078 3300010049 Bacteria 3739
228 Ga0123356_10069400 3300010049 Bacteria 3305
229 Ga0123356_10081067 3300010049 Bacteria 3069
230 Ga0123356_10096533 3300010049 Bacteria 2826
231 Ga0123356_10166899 3300010049 Unclassified 2207
232 Ga0123356_10330013 3300010049 Bacteria 1642
233 Ga0123356_10387626 3300010049 Bacteria 1532
234 Ga0123356_10522219 3300010049 Bacteria 1346
235 Ga0123353_10008780 3300010167 Bacteria 13846
236 Ga0123353_10032349 3300010167 Bacteria 8122
237 Ga0123353_10155754 3300010167 Unclassified 3642
238 Ga0123353_10223462 3300010167 Bacteria 2942
239 Ga0123353_10375418 3300010167 Bacteria 2129
240 Ga0123353_10439669 3300010167 Unclassified 1925
241 Ga0123353_10497895 3300010167 Bacteria 1777
242 Ga0123353_10961429 3300010167 Bacteria 1154
243 Ga0123353_11529672 3300010167 Bacteria 848
244 Ga0160466_100113 3300012809 Bacteria 71251
245 2227205526 2225789004 Unclassified 1427
246 IMNBL1DRAFT_c0016200 3300000062 Bacteria 3202
247 IMNBL1DRAFT_c0034243 3300000062 Bacteria 1810
248 JGI24695J34938_10006662 3300002450 Bacteria 6886
249 JGI24700J35501_10930544 3300002508 Bacteria 15393
250 Ga0466705_189976 3300042612 Bacteria 10634
251 Ga0466731_015669 3300042622 Bacteria 1429
252 Ga0466703_161443 3300042636 Bacteria 27197
253 Ga0466704_075913 3300042643 Unclassified 1562
254 Ga0466704_191022 3300042643 Unclassified 1199
255 Ga0466704_384144 3300042643 Bacteria 22686
256 Ga0466708_217483 3300042652 Bacteria 41447
257 Ga0466708_344244 3300042652 Bacteria 11173
258 Ga0466733_096822 3300042659 Bacteria 2419
259 Ga0160455_101475 3300012837 Bacteria 6957
260 Ga0466690_091470 3300042590 Unclassified 3498
261 Ga0466690_367815 3300042590 Bacteria 2692
262 Ga0466690_417084 3300042590 Unclassified 1085
263 Ga0466693_123372 3300042592 Bacteria 2043
264 Ga0466691_214319 3300042593 Bacteria 2192
265 Ga0466711_118697 3300042615 Bacteria 3301
266 Ga0466723_129995 3300042618 Bacteria 77615
267 Ga0466723_227060 3300042618 Bacteria 5382
268 Ga0466726_073127 3300042619 Bacteria 1188
269 Ga0466726_151736 3300042619 Bacteria 1869
270 Ga0466726_398522 3300042619 Bacteria 5333
271 Ga0466726_403918 3300042619 Bacteria 1359
272 Ga0466706_083252 3300042599 Bacteria 1612
273 Ga0466706_120470 3300042599 Unclassified 1636
274 Ga0466706_170390 3300042599 Bacteria 8997
275 Ga0466706_287220 3300042599 Bacteria 76918
276 Ga0466707_122199 3300042601 Bacteria 9199
277 Ga0466707_205886 3300042601 Bacteria 4190
278 Ga0466707_266855 3300042601 Bacteria 16185
279 Ga0466707_323272 3300042601 Bacteria 1770
280 Ga0466716_084661 3300042605 Bacteria 7974
281 Ga0466716_234460 3300042605 Bacteria 2853
282 Ga0466716_295323 3300042605 Bacteria 2339
283 Ga0466719_133466 3300042606 Bacteria 1685
284 Ga0466719_375604 3300042606 Bacteria 2637
285 Ga0123356_10136051 3300010049 Unclassified 2416
286 Ga0123356_10472552 3300010049 Bacteria 1405
287 Ga0123353_10019862 3300010167 Bacteria 10006
288 Ga0123353_10125583 3300010167 Bacteria 4123
289 Ga0123353_10135634 3300010167 Bacteria 3947
290 Ga0123353_10148456 3300010167 Bacteria 3746
291 Ga0123353_10242677 3300010167 Bacteria 2798
292 Ga0123353_10383695 3300010167 Unclassified 2100
293 Ga0123353_10576176 3300010167 Bacteria 1616
294 Ga0160464_100141 3300012805 Bacteria 78894
295 IMNBGM34_c000904 3300000036 Bacteria 6484
296 IMNBL1DRAFT_c0003298 3300000062 Bacteria 10495
297 SCG598I20_11471 3300000473 Bacteria 4073
298 JGI24703J35330_11363803 3300002501 Bacteria 916
299 Ga0072941_1010257 3300005201 Bacteria 11713
300 Ga0466697_059040 3300042611 Bacteria 3366
301 Ga0466697_063914 3300042611 Bacteria 2161
302 Ga0466705_113029 3300042612 Unclassified 1832
303 Ga0466731_383985 3300042622 Bacteria 2525
304 Ga0466703_081106 3300042636 Unclassified 8771
305 Ga0466703_120405 3300042636 Bacteria 58106
306 Ga0466703_389056 3300042636 Bacteria 12351
307 Ga0466704_198489 3300042643 Bacteria 28563
308 Ga0466724_30566 3300042649 Bacteria 2150
309 Ga0466733_123089 3300042659 Bacteria 1894
310 Ga0562379_1482 3300056790 Bacteria 26501
311 Ga0160467_100011 3300012829 Bacteria 466728
312 Ga0415639_056241 3300038395 Bacteria 1826
313 Ga0466656_171373 3300042550 Bacteria 1010
314 Ga0466690_114171 3300042590 Bacteria 16845
315 Ga0466690_375668 3300042590 Bacteria 1201
316 Ga0466691_061835 3300042593 Unclassified 2809
317 Ga0466691_191688 3300042593 Unclassified 2519
318 Ga0466694_036390 3300042594 Bacteria 15485
319 Ga0466696_034824 3300042596 Bacteria 3212
320 Ga0466696_146828 3300042596 Unclassified 1124
321 Ga0466711_158447 3300042615 Bacteria 22748
322 Ga0466715_443211 3300042616 Bacteria 5444
323 Ga0466715_455838 3300042616 Bacteria 6565
324 Ga0466718_031641 3300042617 Bacteria 1982
325 Ga0466723_144455 3300042618 Unclassified 3834
326 Ga0466723_264474 3300042618 Bacteria 8750
327 Ga0466726_380339 3300042619 Bacteria 18173
328 Ga0466726_428865 3300042619 Bacteria 1843
329 Ga0466728_151798 3300042620 Unclassified 2623
330 Ga0466728_191792 3300042620 Unclassified 1367
331 Ga0466706_116693 3300042599 Bacteria 75484
332 Ga0466706_209709 3300042599 Bacteria 12771
333 Ga0466700_258519 3300042600 Bacteria 1036
334 Ga0466707_032152 3300042601 Unclassified 2789
335 Ga0466713_095526 3300042602 Bacteria 106941
336 Ga0466713_147119 3300042602 Bacteria 2166
337 Ga0466714_069537 3300042603 Bacteria 1724
338 Ga0466714_118588 3300042603 Bacteria 1532
339 Ga0466719_016156 3300042606 Unclassified 1589
340 Ga0466719_174850 3300042606 Unclassified 1870
341 Ga0466722_249891 3300042609 Unclassified 2824
342 Ga0123355_10002248 3300009826 Unclassified 27261
343 Ga0123355_10027888 3300009826 Bacteria 9125
344 Ga0123355_10101302 3300009826 Unclassified 4534
345 Ga0123355_10123470 3300009826 Bacteria 4010
346 Ga0123355_10184443 3300009826 Bacteria 3089
347 Ga0123355_11173611 3300009826 Bacteria 788
348 Ga0123356_10027766 3300010049 Bacteria 5303
349 Ga0123356_10030181 3300010049 Bacteria 5074
350 Ga0123356_10042249 3300010049 Bacteria 4247
351 Ga0123356_10081084 3300010049 Bacteria 3069
352 Ga0123356_11011286 3300010049 Bacteria 1001
353 Ga0123353_10039473 3300010167 Bacteria 7432
354 Ga0123353_10107781 3300010167 Bacteria 4489
355 Ga0123353_10271601 3300010167 Bacteria 2612
356 Ga0123353_10777321 3300010167 Bacteria 1327
357 Ga0123354_10076287 3300010882 Unclassified 4786
358 Ga0160464_100858 3300012805 Bacteria 15901
359 Ga0160466_100134 3300012809 Bacteria 60359
360 IMNBL1DRAFT_c0001553 3300000062 Bacteria 17103
361 IMNBL1DRAFT_c0084593 3300000062 Bacteria 882
362 JGI24695J34938_10000214 3300002450 Bacteria 55263
363 JGI24705J35276_12238001 3300002504 Bacteria 14897
364 Ga0063521_1000156 3300003973 Bacteria 51654
365 Ga0068305_10003492 3300005083 Bacteria 6039
366 Ga0466729_257209 3300042621 Bacteria 2648
367 Ga0466729_277926 3300042621 Bacteria 1372
368 Ga0466731_171473 3300042622 Bacteria 3709
369 Ga0466703_116491 3300042636 Bacteria 106772
370 Ga0466703_313131 3300042636 Bacteria 25741
371 Ga0466704_150592 3300042643 Bacteria 2322
372 Ga0466704_231892 3300042643 Bacteria 16710
373 Ga0466704_369229 3300042643 Bacteria 1328
374 Ga0466704_491376 3300042643 Bacteria 86783
375 Ga0466709_283466 3300042648 Bacteria 1973
376 Ga0466708_359241 3300042652 Bacteria 123978
377 Ga0466733_121233 3300042659 Bacteria 1700
378 Ga0562375_0302 3300056856 Bacteria 123319
379 Ga0255809_1023407 3300022820 Bacteria 3713
380 Ga0466693_421860 3300042592 Bacteria 1184
381 Ga0466694_345612 3300042594 Bacteria 5174
382 Ga0466695_235746 3300042595 Bacteria 4200
383 Ga0466695_387385 3300042595 Bacteria 2973
384 Ga0466695_392309 3300042595 Bacteria 1392
385 Ga0466696_104038 3300042596 Bacteria 1549
386 Ga0466705_421853 3300042612 Bacteria 2436
387 Ga0466705_485073 3300042612 Bacteria 6923
388 Ga0466711_005644 3300042615 Bacteria 24467
389 Ga0466715_524240 3300042616 Bacteria 6078
390 Ga0466723_287560 3300042618 Bacteria 2094
391 Ga0466726_279937 3300042619 Unclassified 3419
392 Ga0466729_090938 3300042621 Bacteria 1796
393 Ga0466706_081622 3300042599 Bacteria 1515
394 Ga0466706_176163 3300042599 Bacteria 2899
395 Ga0466700_244163 3300042600 Bacteria 2255
396 Ga0466707_017088 3300042601 Bacteria 60022
397 Ga0466707_089230 3300042601 Bacteria 4071
398 Ga0466707_176162 3300042601 Bacteria 62223
399 Ga0466707_306395 3300042601 Bacteria 2351
400 Ga0466707_317272 3300042601 Bacteria 1406
401 Ga0466716_176279 3300042605 Unclassified 1047
402 Ga0466716_329271 3300042605 Bacteria 2075
403 Ga0466716_473584 3300042605 Bacteria 7859
404 Ga0466719_157639 3300042606 Bacteria 1122
405 Ga0466719_215794 3300042606 Bacteria 1491
406 Ga0466719_438685 3300042606 Bacteria 12208
407 Ga0466697_008266 3300042611 Bacteria 1383
408 Ga0123355_11024249 3300009826 Bacteria 872
409 Ga0123356_10000009 3300010049 Bacteria 226788
410 Ga0123356_10058819 3300010049 Bacteria 3585
411 Ga0123356_10119816 3300010049 Bacteria 2557
412 Ga0123356_10140472 3300010049 Unclassified 2382
413 Ga0123356_10461358 3300010049 Bacteria 1420
414 Ga0123356_10474140 3300010049 Bacteria 1403
415 Ga0123356_10550708 3300010049 Bacteria 1314
416 Ga0123356_10629129 3300010049 Bacteria 1239
417 Ga0123356_11656727 3300010049 Bacteria 793
418 Ga0123353_10034336 3300010167 Bacteria 7914
419 Ga0123353_10093130 3300010167 Bacteria 4855
420 Ga0123353_10135159 3300010167 Bacteria 3955
421 Ga0123353_10512876 3300010167 Bacteria 1742
422 Ga0123353_10805466 3300010167 Bacteria 1296
423 Ga0123353_11016264 3300010167 Bacteria 1112
424 Ga0123353_11293093 3300010167 Bacteria 948
425 Ga0123353_12056055 3300010167 Bacteria 697
426 Ga0123354_10301258 3300010882 Unclassified 1516
427 Ga0123354_10303798 3300010882 Bacteria 1504
428 2227099714 2225789004 Unclassified 1797
429 IMNBL1DRAFT_c0016967 3300000062 Bacteria 3089
430 JGI24703J35330_11742007 3300002501 Bacteria 3629
431 Ga0068302_10013573 3300005071 Bacteria 4875
432 Ga0123357_10002163 3300009784 Bacteria 21663
433 Ga0466697_132907 3300042611 Bacteria 3319
434 Ga0466705_267852 3300042612 Unclassified 5827
435 Ga0466703_056011 3300042636 Bacteria 1432
436 Ga0466704_104792 3300042643 Bacteria 86535
437 Ga0466704_136674 3300042643 Unclassified 2479
438 Ga0466708_260886 3300042652 Unclassified 17352
439 Ga0466708_268041 3300042652 Bacteria 9117
440 Ga0562379_3236 3300056790 Bacteria 11285
441 Ga0466692_058025 3300042591 Bacteria 17694
442 Ga0466705_417523 3300042612 Bacteria 7177
443 Ga0466705_486214 3300042612 Bacteria 9215
444 Ga0466705_524998 3300042612 Bacteria 1431
445 Ga0466711_126980 3300042615 Bacteria 7138
446 Ga0466711_298534 3300042615 Bacteria 7644
447 Ga0466715_308307 3300042616 Bacteria 14012
448 Ga0466715_440964 3300042616 Bacteria 1169
449 Ga0466715_560574 3300042616 Bacteria 15866
450 Ga0466715_637194 3300042616 Bacteria 5213
451 Ga0466723_095973 3300042618 Bacteria 2023
452 Ga0466723_139237 3300042618 Bacteria 4584
453 Ga0466723_235913 3300042618 Bacteria 5907
454 Ga0466723_301720 3300042618 Bacteria 4527
455 Ga0466726_142470 3300042619 Bacteria 12230
456 Ga0466707_276563 3300042601 Bacteria 2263
457 Ga0466714_011911 3300042603 Bacteria 1495
458 Ga0466717_021007 3300042604 Bacteria 1226
459 Ga0466716_232214 3300042605 Unclassified 5447
460 Ga0466722_025291 3300042609 Bacteria 3791
461 Ga0123355_10000534 3300009826 Bacteria 50886
462 Ga0123356_10001257 3300010049 Bacteria 28049
463 Ga0123356_10013773 3300010049 Unclassified 7788
464 Ga0123356_10286144 3300010049 Bacteria 1746
465 Ga0123356_10979057 3300010049 Bacteria 1016
466 Ga0123356_11152686 3300010049 Unclassified 942
467 Ga0123356_11279893 3300010049 Bacteria 897
468 Ga0123353_10000147 3300010167 Bacteria 87419
469 Ga0123353_10004138 3300010167 Bacteria 18616
470 Ga0123353_10104650 3300010167 Bacteria 4561
471 Ga0123353_10110611 3300010167 Bacteria 4426
472 Ga0123353_10216669 3300010167 Bacteria 2998
473 Ga0123353_10234943 3300010167 Unclassified 2854
474 Ga0123353_10731401 3300010167 Bacteria 1381
475 Ga0123353_10759746 3300010167 Bacteria 1347
476 Ga0123353_10769741 3300010167 Bacteria 1336
477 Ga0123353_10936414 3300010167 Bacteria 1174
478 Ga0123354_10171041 3300010882 Bacteria 2528
479 Ga0123354_10426417 3300010882 Unclassified 1097
480 Ga0160470_100124 3300012813 Bacteria 82153
481 2227386356 2225789004 Bacteria 27117
482 2227480197 2225789004 Bacteria 22192
483 2227651307 2225789004 Bacteria 2000
484 IMNBL1DRAFT_c0000015 3300000062 Bacteria 179817
485 IMNBL1DRAFT_c0000018 3300000062 Bacteria 172634
486 IMNBL1DRAFT_c0000174 3300000062 Bacteria 57893
487 JGI24695J34938_10000106 3300002450 Bacteria 73679
488 JGI24695J34938_10111508 3300002450 Bacteria 1114
489 JGI24702J35022_10009964 3300002462 Bacteria 5324
490 JGI24705J35276_12216034 3300002504 Bacteria 2028
491 JGI24697J35500_11274522 3300002507 Bacteria 7621
492 JGI24696J40584_12935422 3300002834 Bacteria 1559
493 Ga0063521_1000201 3300003973 Unclassified 43047
494 Ga0068305_10004579 3300005083 Bacteria 7568
495 Ga0072941_1131248 3300005201 Bacteria 8370
496 Ga0466705_260749 3300042612 Bacteria 23388
497 Ga0466734_003920 3300042623 Bacteria 1162
498 Ga0466703_389788 3300042636 Bacteria 1351
499 Ga0466704_057341 3300042643 Bacteria 1588
500 Ga0466727_183346 3300042655 Bacteria 8748

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00574 CLP_protease Clp protease 52 230 0.99

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.