Protein Family IF02305
Metagenome
Isolate
318
Members
147
Samples
222
Scaffolds
265.22
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10001345|Ga0123355_1000134523
- Length
- 264 aa
- Sequence
- MGEVIVITSGKGGVGKTTTTANLGAALSLHGKRVVVIDADLGLRNLDVVLGVEENIIFDITDVFDERCKLEDALIQNRHCPNLFLLPASQTASKDSIEPEQMKKLCTDLKNKFDYVLIDCPAGIEQGFKNAMCAAERALIVATPDVSSVRDADRIYRILMSDNRSVQANLILNRVRIDLLEQKAQMNAEDITELIPIDLIGIVPDDSGIIIAASRGETVAANSRSSPGGAYRDIAKRIRGEEVEFMDLREKTGFFSKLRKVFK*
Sample Types
Isolate
30.2%
Metagenome
69.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
49.3%
Termitidae
20.1%
Kalotermitidae
5.6%
Pyralidae
4.2%
Apidae
2.8%
Passalidae
2.1%
Blattidae
2.1%
Rhinotermitidae
2.1%
Elmidae
1.4%
Culicidae
1.4%
Scarabaeidae
1.4%
Bombycidae
1.4%
Portunidae
0.7%
Calliphoridae
0.7%
Hodotermitidae
0.7%
Noctuidae
0.7%
Eresidae
0.7%
Ocypodidae
0.7%
Termopsidae
0.7%
Tenebrionidae
0.7%
Curculionidae
0.7%
Taxonomy
Archaea
0
Bacteria
301
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 2 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 3 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 4 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 5 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 6 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 7 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 8 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 9 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 10 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 11 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 12 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 13 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 14 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 15 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 16 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 17 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 18 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 21 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 22 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 23 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 24 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 25 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 26 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 27 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 28 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 29 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 30 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 31 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 32 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 33 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 36 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 42 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 47 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 48 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 49 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 50 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 51 | 2820581541 | Unclassified Firmicutes Emb289P3bin127 | Isolate | Unclassified |
| 52 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 53 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 54 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 55 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 56 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 57 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 58 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 59 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 60 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 61 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 62 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 63 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 64 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 65 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 66 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 67 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 68 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 69 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 70 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 71 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 72 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 73 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 74 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 75 | 2820636287 | Unclassified Firmicutes Emb289P1bin112 | Isolate | Unclassified |
| 76 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 77 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 78 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 79 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 80 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 81 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 82 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 83 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 84 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 85 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 86 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 87 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 88 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 89 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 90 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 91 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 92 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 93 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 94 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 95 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 96 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 97 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 98 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 99 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 100 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 101 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 102 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 103 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 104 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 105 | 2820633305 | Unclassified Firmicutes Emb289P1bin118 | Isolate | Unclassified |
| 106 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 107 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 108 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 109 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 110 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 111 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 112 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 113 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 114 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 115 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 116 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 117 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 118 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 119 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 120 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 121 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 122 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 123 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 124 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 125 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 126 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 127 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 128 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 129 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 130 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 131 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 132 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 133 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 134 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 135 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 136 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 137 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 138 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 139 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 140 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 141 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 142 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 143 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 144 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 145 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 146 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 147 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10000749 | 3300009826 | Bacteria | 44336 |
| 2 | Ga0123355_10001345 | 3300009826 | Bacteria | 34127 |
| 3 | Ga0123355_10002236 | 3300009826 | Bacteria | 27325 |
| 4 | Ga0123355_10003740 | 3300009826 | Bacteria | 21973 |
| 5 | Ga0123355_10009773 | 3300009826 | Bacteria | 14628 |
| 6 | Ga0123355_10015237 | 3300009826 | Bacteria | 12070 |
| 7 | Ga0123355_10209424 | 3300009826 | Bacteria | 2829 |
| 8 | Ga0123355_10226726 | 3300009826 | Bacteria | 2676 |
| 9 | Ga0123355_10228896 | 3300009826 | Bacteria | 2658 |
| 10 | Ga0123355_10335487 | 3300009826 | Bacteria | 2020 |
| 11 | Ga0123355_10717212 | 3300009826 | Bacteria | 1142 |
| 12 | Ga0123355_10798884 | 3300009826 | Bacteria | 1053 |
| 13 | Ga0123355_10870690 | 3300009826 | Bacteria | 986 |
| 14 | Ga0123353_10000021 | 3300010167 | Bacteria | 176788 |
| 15 | Ga0123353_10055538 | 3300010167 | Bacteria | 6336 |
| 16 | Ga0123353_11264700 | 3300010167 | Bacteria | 962 |
| 17 | Ga0466730_036688 | 3300042625 | Unclassified | 4072 |
| 18 | Ga0466701_021239 | 3300042598 | Bacteria | 69029 |
| 19 | Ga0466701_089112 | 3300042598 | Bacteria | 3433 |
| 20 | Ga0466700_171599 | 3300042600 | Bacteria | 1532 |
| 21 | Ga0466707_120789 | 3300042601 | Bacteria | 129814 |
| 22 | Ga0466713_136786 | 3300042602 | Bacteria | 1644 |
| 23 | Ga0466713_154253 | 3300042602 | Bacteria | 5550 |
| 24 | Ga0466714_000592 | 3300042603 | Bacteria | 5592 |
| 25 | Ga0466714_115443 | 3300042603 | Unclassified | 1012 |
| 26 | 2227632947 | 2225789004 | Unclassified | 11329 |
| 27 | JGI24703J35330_11499064 | 3300002501 | Bacteria | 1114 |
| 28 | JGI24703J35330_11687579 | 3300002501 | Bacteria | 1872 |
| 29 | JGI24703J35330_11747205 | 3300002501 | Bacteria | 6329 |
| 30 | JGI24703J35330_11748742 | 3300002501 | Bacteria | 30568 |
| 31 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 32 | Ga0415639_087612 | 3300038395 | Bacteria | 1899 |
| 33 | Ga0123355_10000007 | 3300009826 | Bacteria | 193006 |
| 34 | Ga0123355_10002620 | 3300009826 | Bacteria | 25530 |
| 35 | Ga0123355_10003156 | 3300009826 | Bacteria | 23518 |
| 36 | Ga0123355_10003367 | 3300009826 | Bacteria | 22894 |
| 37 | Ga0123355_10092782 | 3300009826 | Bacteria | 4781 |
| 38 | Ga0123355_10119047 | 3300009826 | Bacteria | 4101 |
| 39 | Ga0123355_10415050 | 3300009826 | Bacteria | 1725 |
| 40 | Ga0123353_10095333 | 3300010167 | Bacteria | 4794 |
| 41 | Ga0123353_10128119 | 3300010167 | Bacteria | 4076 |
| 42 | Ga0466706_137408 | 3300042599 | Bacteria | 2816 |
| 43 | Ga0466714_043478 | 3300042603 | Bacteria | 3516 |
| 44 | Ga0466714_056381 | 3300042603 | Bacteria | 50804 |
| 45 | Ga0466717_096613 | 3300042604 | Bacteria | 5553 |
| 46 | Ga0466698_018100 | 3300042610 | Bacteria | 18880 |
| 47 | IMNBL1DRAFT_c0000179 | 3300000062 | Bacteria | 56432 |
| 48 | IMNBL1DRAFT_c0024056 | 3300000062 | Bacteria | 2370 |
| 49 | JGI24695J34938_10000808 | 3300002450 | Bacteria | 29090 |
| 50 | Ga0466733_141863 | 3300042659 | Bacteria | 2305 |
| 51 | Ga0466715_365676 | 3300042616 | Bacteria | 1182 |
| 52 | Ga0415639_009082 | 3300038395 | Bacteria | 7372 |
| 53 | Ga0466693_207265 | 3300042592 | Bacteria | 2741 |
| 54 | Ga0123357_10366099 | 3300009784 | Unclassified | 1358 |
| 55 | Ga0123355_10003147 | 3300009826 | Bacteria | 23572 |
| 56 | Ga0123355_10003801 | 3300009826 | Bacteria | 21823 |
| 57 | Ga0123355_10021577 | 3300009826 | Bacteria | 10309 |
| 58 | Ga0123355_10031874 | 3300009826 | Bacteria | 8555 |
| 59 | Ga0123355_10074864 | 3300009826 | Bacteria | 5422 |
| 60 | Ga0123355_10092032 | 3300009826 | Bacteria | 4805 |
| 61 | Ga0123355_10101748 | 3300009826 | Bacteria | 4521 |
| 62 | Ga0123355_10185332 | 3300009826 | Bacteria | 3079 |
| 63 | Ga0123355_10326201 | 3300009826 | Bacteria | 2062 |
| 64 | Ga0123355_10503817 | 3300009826 | Bacteria | 1492 |
| 65 | Ga0123353_10089914 | 3300010167 | Bacteria | 4944 |
| 66 | Ga0123353_10401859 | 3300010167 | Unclassified | 2038 |
| 67 | Ga0123353_10828002 | 3300010167 | Bacteria | 1273 |
| 68 | Ga0466725_368763 | 3300042654 | Bacteria | 54660 |
| 69 | Ga0466714_038747 | 3300042603 | Bacteria | 1929 |
| 70 | Ga0466717_295632 | 3300042604 | Bacteria | 1272 |
| 71 | 2227065520 | 2225789003 | Bacteria | 3392 |
| 72 | IMNBL1DRAFT_c0030860 | 3300000062 | Bacteria | 1958 |
| 73 | JGI24695J34938_10000526 | 3300002450 | Bacteria | 37197 |
| 74 | JGI24695J34938_10004972 | 3300002450 | Bacteria | 8482 |
| 75 | JGI24703J35330_11689337 | 3300002501 | Bacteria | 1889 |
| 76 | JGI24700J35501_10930223 | 3300002508 | Bacteria | 12256 |
| 77 | JGI24700J35501_10930549 | 3300002508 | Bacteria | 15506 |
| 78 | Ga0466715_540329 | 3300042616 | Unclassified | 6832 |
| 79 | Ga0466726_085329 | 3300042619 | Bacteria | 10095 |
| 80 | Ga0415639_006071 | 3300038395 | Bacteria | 19511 |
| 81 | Ga0466693_260077 | 3300042592 | Bacteria | 1323 |
| 82 | Ga0123355_10000063 | 3300009826 | Bacteria | 114264 |
| 83 | Ga0123355_10000168 | 3300009826 | Bacteria | 79476 |
| 84 | Ga0123355_10004887 | 3300009826 | Bacteria | 19502 |
| 85 | Ga0123355_10009578 | 3300009826 | Bacteria | 14756 |
| 86 | Ga0123355_10011252 | 3300009826 | Unclassified | 13778 |
| 87 | Ga0123355_10017061 | 3300009826 | Bacteria | 11463 |
| 88 | Ga0123355_10017756 | 3300009826 | Bacteria | 11251 |
| 89 | Ga0123355_10018255 | 3300009826 | Bacteria | 11116 |
| 90 | Ga0123355_10025541 | 3300009826 | Bacteria | 9512 |
| 91 | Ga0123355_10035578 | 3300009826 | Unclassified | 8094 |
| 92 | Ga0123355_10064516 | 3300009826 | Bacteria | 5901 |
| 93 | Ga0123355_10108260 | 3300009826 | Bacteria | 4352 |
| 94 | Ga0123355_10123578 | 3300009826 | Bacteria | 4008 |
| 95 | Ga0123355_10217342 | 3300009826 | Unclassified | 2756 |
| 96 | Ga0123355_10254734 | 3300009826 | Bacteria | 2465 |
| 97 | Ga0123355_10509040 | 3300009826 | Bacteria | 1480 |
| 98 | Ga0123356_10419945 | 3300010049 | Bacteria | 1479 |
| 99 | Ga0123353_10034949 | 3300010167 | Bacteria | 7855 |
| 100 | Ga0466704_024382 | 3300042643 | Bacteria | 47229 |
| 101 | Ga0466725_289940 | 3300042654 | Bacteria | 3434 |
| 102 | Ga0466706_067284 | 3300042599 | Bacteria | 1347 |
| 103 | Ga0466706_095179 | 3300042599 | Bacteria | 4159 |
| 104 | Ga0466714_011036 | 3300042603 | Bacteria | 8946 |
| 105 | Ga0466714_026375 | 3300042603 | Bacteria | 121146 |
| 106 | Ga0466714_094207 | 3300042603 | Bacteria | 15657 |
| 107 | Ga0466721_363510 | 3300042608 | Bacteria | 1885 |
| 108 | IMNBL1DRAFT_c0000037 | 3300000062 | Bacteria | 119833 |
| 109 | JGI24702J35022_10019182 | 3300002462 | Bacteria | 3722 |
| 110 | JGI24703J35330_11738577 | 3300002501 | Bacteria | 3211 |
| 111 | JGI24703J35330_11748351 | 3300002501 | Bacteria | 14440 |
| 112 | JGI24700J35501_10930933 | 3300002508 | Bacteria | 64079 |
| 113 | Ga0063521_1000490 | 3300003973 | Bacteria | 18886 |
| 114 | Ga0072941_1000935 | 3300005201 | Bacteria | 118687 |
| 115 | Ga0466715_545967 | 3300042616 | Bacteria | 48516 |
| 116 | Ga0466726_252051 | 3300042619 | Bacteria | 23339 |
| 117 | Ga0415639_007784 | 3300038395 | Bacteria | 15150 |
| 118 | Ga0415639_014391 | 3300038395 | Unclassified | 9212 |
| 119 | Ga0415639_023397 | 3300038395 | Bacteria | 19409 |
| 120 | Ga0415639_037803 | 3300038395 | Bacteria | 6301 |
| 121 | Ga0415639_045748 | 3300038395 | Bacteria | 4620 |
| 122 | Ga0466692_031604 | 3300042591 | Bacteria | 1776 |
| 123 | Ga0466695_099096 | 3300042595 | Bacteria | 5944 |
| 124 | Ga0466699_185481 | 3300042597 | Bacteria | 1311 |
| 125 | Ga0123355_10000175 | 3300009826 | Bacteria | 78816 |
| 126 | Ga0123355_10000338 | 3300009826 | Bacteria | 60591 |
| 127 | Ga0123355_10001854 | 3300009826 | Bacteria | 29630 |
| 128 | Ga0123355_10002603 | 3300009826 | Bacteria | 25595 |
| 129 | Ga0123355_10004149 | 3300009826 | Unclassified | 21022 |
| 130 | Ga0123355_10012339 | 3300009826 | Bacteria | 13235 |
| 131 | Ga0123355_10015035 | 3300009826 | Bacteria | 12141 |
| 132 | Ga0123355_10125454 | 3300009826 | Bacteria | 3968 |
| 133 | Ga0123355_10233460 | 3300009826 | Bacteria | 2622 |
| 134 | Ga0123355_10262769 | 3300009826 | Bacteria | 2411 |
| 135 | Ga0123355_10365120 | 3300009826 | Bacteria | 1897 |
| 136 | Ga0123355_10577783 | 3300009826 | Bacteria | 1345 |
| 137 | Ga0123356_10086864 | 3300010049 | Bacteria | 2970 |
| 138 | Ga0123353_10169561 | 3300010167 | Bacteria | 3466 |
| 139 | Ga0123353_10563148 | 3300010167 | Bacteria | 1640 |
| 140 | Ga0466709_401112 | 3300042648 | Bacteria | 7577 |
| 141 | Ga0466714_068310 | 3300042603 | Unclassified | 1668 |
| 142 | Ga0466717_278957 | 3300042604 | Bacteria | 1342 |
| 143 | 2227591316 | 2225789004 | Bacteria | 2420 |
| 144 | IMNBL1DRAFT_c0000006 | 3300000062 | Bacteria | 247403 |
| 145 | IMNBL1DRAFT_c0000524 | 3300000062 | Bacteria | 31413 |
| 146 | JGI24695J34938_10001051 | 3300002450 | Bacteria | 25055 |
| 147 | JGI24703J35330_11748634 | 3300002501 | Bacteria | 22914 |
| 148 | JGI24700J35501_10840561 | 3300002508 | Bacteria | 1867 |
| 149 | Ga0466733_144162 | 3300042659 | Bacteria | 30144 |
| 150 | Ga0466710_344376 | 3300042613 | Bacteria | 2415 |
| 151 | Ga0466715_150047 | 3300042616 | Bacteria | 36126 |
| 152 | Ga0415639_066512 | 3300038395 | Bacteria | 10219 |
| 153 | Ga0466656_037978 | 3300042550 | Bacteria | 2161 |
| 154 | Ga0466693_176626 | 3300042592 | Bacteria | 5933 |
| 155 | Ga0123355_10003956 | 3300009826 | Bacteria | 21447 |
| 156 | Ga0123355_10004822 | 3300009826 | Bacteria | 19636 |
| 157 | Ga0123355_10017764 | 3300009826 | Bacteria | 11249 |
| 158 | Ga0123355_10089331 | 3300009826 | Bacteria | 4890 |
| 159 | Ga0123355_10094058 | 3300009826 | Bacteria | 4742 |
| 160 | Ga0123353_10218113 | 3300010167 | Bacteria | 2986 |
| 161 | Ga0123353_10889559 | 3300010167 | Bacteria | 1214 |
| 162 | Ga0123353_11356610 | 3300010167 | Bacteria | 918 |
| 163 | Ga0123354_10357212 | 3300010882 | Bacteria | 1293 |
| 164 | Ga0160466_100134 | 3300012809 | Bacteria | 60359 |
| 165 | Ga0466708_041429 | 3300042652 | Bacteria | 60442 |
| 166 | Ga0466725_004301 | 3300042654 | Bacteria | 15455 |
| 167 | Ga0466706_192003 | 3300042599 | Bacteria | 2851 |
| 168 | Ga0466714_099956 | 3300042603 | Bacteria | 3306 |
| 169 | Ga0466697_001007 | 3300042611 | Bacteria | 2642 |
| 170 | 2227646823 | 2225789004 | Bacteria | 44086 |
| 171 | IMNBL1DRAFT_c0001495 | 3300000062 | Bacteria | 17425 |
| 172 | Ga0466705_138396 | 3300042612 | Bacteria | 10129 |
| 173 | Ga0466726_049760 | 3300042619 | Bacteria | 16937 |
| 174 | Ga0415639_000437 | 3300038395 | Bacteria | 52540 |
| 175 | Ga0415639_059501 | 3300038395 | Bacteria | 3674 |
| 176 | Ga0466693_038770 | 3300042592 | Bacteria | 1500 |
| 177 | Ga0466696_503334 | 3300042596 | Bacteria | 1012 |
| 178 | Ga0123355_10002791 | 3300009826 | Bacteria | 24777 |
| 179 | Ga0123355_10012722 | 3300009826 | Bacteria | 13047 |
| 180 | Ga0123355_10030396 | 3300009826 | Bacteria | 8753 |
| 181 | Ga0123355_10127576 | 3300009826 | Bacteria | 3927 |
| 182 | Ga0123355_10224054 | 3300009826 | Bacteria | 2698 |
| 183 | Ga0123355_10267090 | 3300009826 | Bacteria | 2384 |
| 184 | Ga0123355_10611494 | 3300009826 | Bacteria | 1289 |
| 185 | Ga0123355_10652465 | 3300009826 | Unclassified | 1227 |
| 186 | Ga0123353_10002310 | 3300010167 | Bacteria | 23672 |
| 187 | Ga0123354_10430924 | 3300010882 | Bacteria | 1086 |
| 188 | Ga0160471_103628 | 3300012812 | Bacteria | 2291 |
| 189 | Ga0466729_312970 | 3300042621 | Bacteria | 7387 |
| 190 | Ga0466703_138218 | 3300042636 | Bacteria | 2002 |
| 191 | Ga0466714_164385 | 3300042603 | Unclassified | 1487 |
| 192 | Ga0072940_1529641 | 3300005200 | Bacteria | 1035 |
| 193 | Ga0466697_168883 | 3300042611 | Bacteria | 1652 |
| 194 | Ga0466733_084069 | 3300042659 | Bacteria | 1968 |
| 195 | Ga0466705_421227 | 3300042612 | Bacteria | 41329 |
| 196 | Ga0415639_064173 | 3300038395 | Bacteria | 5135 |
| 197 | Ga0415639_071376 | 3300038395 | Unclassified | 6255 |
| 198 | Ga0123357_10191039 | 3300009784 | Bacteria | 2359 |
| 199 | Ga0123355_10001527 | 3300009826 | Bacteria | 32307 |
| 200 | Ga0123355_10011557 | 3300009826 | Bacteria | 13615 |
| 201 | Ga0123355_10086558 | 3300009826 | Unclassified | 4983 |
| 202 | Ga0123355_10123538 | 3300009826 | Bacteria | 4009 |
| 203 | Ga0123355_10146689 | 3300009826 | Bacteria | 3596 |
| 204 | Ga0123355_10156082 | 3300009826 | Bacteria | 3452 |
| 205 | Ga0123355_10164290 | 3300009826 | Bacteria | 3336 |
| 206 | Ga0123355_10168889 | 3300009826 | Bacteria | 3275 |
| 207 | Ga0123355_10178473 | 3300009826 | Bacteria | 3157 |
| 208 | Ga0123355_10268663 | 3300009826 | Bacteria | 2374 |
| 209 | Ga0123355_10269635 | 3300009826 | Bacteria | 2367 |
| 210 | Ga0123355_10620172 | 3300009826 | Unclassified | 1275 |
| 211 | Ga0123356_10056276 | 3300010049 | Bacteria | 3664 |
| 212 | Ga0123353_10568677 | 3300010167 | Bacteria | 1630 |
| 213 | Ga0123353_10619329 | 3300010167 | Bacteria | 1541 |
| 214 | Ga0123354_10005592 | 3300010882 | Bacteria | 18329 |
| 215 | Ga0123354_10297470 | 3300010882 | Bacteria | 1534 |
| 216 | Ga0466702_363969 | 3300042635 | Bacteria | 1073 |
| 217 | Ga0466725_030481 | 3300042654 | Bacteria | 19024 |
| 218 | Ga0466714_161816 | 3300042603 | Bacteria | 3494 |
| 219 | Ga0466719_376048 | 3300042606 | Bacteria | 2755 |
| 220 | Ga0466722_155852 | 3300042609 | Bacteria | 3372 |
| 221 | IMNBL1DRAFT_c0004954 | 3300000062 | Bacteria | 7777 |
| 222 | Ga0068305_10026255 | 3300005083 | Bacteria | 14630 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01656 | CbiA | CobQ/CobB/MinD/ParA nucleotide binding domain | 5 | 219 | 0.95 |
| PF02374 | ArsA_ATPase | Anion-transporting ATPase | 5 | 40 | 0.93 |
| PF13614 | AAA_31 | AAA domain | 3 | 160 | 0.87 |
| PF00142 | Fer4_NifH | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family | 8 | 242 | 0.8 |
| PF06564 | CBP_BcsQ | Cellulose biosynthesis protein BcsQ | 4 | 148 | 0.79 |
| PF10609 | ParA | NUBPL iron-transfer P-loop NTPase | 3 | 238 | 0.76 |
| PF09140 | MipZ | ATPase MipZ | 4 | 158 | 0.73 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.