Protein Family IF02013
Metagenome
Metatranscriptome
Isolate
201
Members
83
Samples
175
Scaffolds
92.45
Avg Length
Representative Sequence
- ID
- 3300007505|Ga0105005_1302262|Ga0105005_13022622
- Length
- 103 aa
- Sequence
- VARSLKKGPYCSPKLLKKVIKLRKEAGGRGRVVVQVWSRSSVIMPEFVGATLMVHNGKIFVPVLVNENMVGHKVGEFSMTRTFRGHSGDKKTAAPAAKQSDK*
Sample Types
Isolate
12.9%
Metagenome
86.6%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.5%
Unclassified
33.3%
Kalotermitidae
13.6%
Termopsidae
3.7%
Passalidae
2.5%
Rhinotermitidae
2.5%
Blaberidae
1.2%
Hodotermitidae
1.2%
Drosophilidae
1.2%
Lamproblattidae
1.2%
Taxonomy
Archaea
0
Bacteria
180
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 2 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 3 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 4 | 2820549969 | Unclassified Firmicutes Emb289P4bin66 | Isolate | Unclassified |
| 5 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 2820721785 | Unclassified Fibrobacteres Lab288P1bin58 | Isolate | Unclassified |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 2820854745 | Unclassified Actinobacteria Lab288P3bin234 | Isolate | Unclassified |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 25 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 35 | 2772190895 | Unclassified Elusimicrobia Emb289P1_bin39 | Isolate | Unclassified |
| 36 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 37 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 38 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 44 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 45 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 46 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 47 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 48 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 51 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 52 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 53 | 2778260936 | Unclassified Fibrobacteres Co191P3bin13 | Isolate | Unclassified |
| 54 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 55 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 56 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 57 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 58 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 59 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 60 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 61 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 62 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 63 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 64 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 65 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 66 | 2820711732 | Unclassified Firmicutes Co191P1bin26 | Isolate | Unclassified |
| 67 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 68 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 69 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 70 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 71 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 72 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 73 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 74 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 75 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 76 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 77 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 78 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 79 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 80 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 81 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 82 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 83 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_041624 | 3300042659 | Bacteria | 3986 |
| 2 | Ga0233288_1002398 | 3300022232 | Bacteria | 1432 |
| 3 | Ga0265387_1000159 | 3300024582 | Bacteria | 12397 |
| 4 | Ga0466694_237102 | 3300042594 | Bacteria | 1216 |
| 5 | Ga0466694_401170 | 3300042594 | Bacteria | 1016 |
| 6 | Ga0466696_053065 | 3300042596 | Bacteria | 22769 |
| 7 | Ga0466699_409111 | 3300042597 | Bacteria | 2759 |
| 8 | Ga0466711_268245 | 3300042615 | Bacteria | 15728 |
| 9 | Ga0466734_061713 | 3300042623 | Bacteria | 7989 |
| 10 | Ga0466702_129145 | 3300042635 | Bacteria | 18302 |
| 11 | Ga0466704_525120 | 3300042643 | Bacteria | 8699 |
| 12 | Ga0123357_10989576 | 3300009784 | Unclassified | 525 |
| 13 | Ga0123355_10924432 | 3300009826 | Unclassified | 942 |
| 14 | Ga0123356_10367062 | 3300010049 | Bacteria | 1568 |
| 15 | Ga0123353_10000803 | 3300010167 | Bacteria | 38182 |
| 16 | Ga0123353_10137894 | 3300010167 | Bacteria | 3911 |
| 17 | Ga0123353_11510414 | 3300010167 | Bacteria | 855 |
| 18 | IMNBL1DRAFT_c0001685 | 3300000062 | Bacteria | 16309 |
| 19 | Ga0072940_1219897 | 3300005200 | Unclassified | 1394 |
| 20 | Ga0072940_1484112 | 3300005200 | Bacteria | 561 |
| 21 | Ga0105005_1036411 | 3300007505 | Bacteria | 3130 |
| 22 | Ga0466700_260085 | 3300042600 | Bacteria | 4561 |
| 23 | Ga0466713_104587 | 3300042602 | Bacteria | 60209 |
| 24 | Ga0415639_012074 | 3300038395 | Bacteria | 26131 |
| 25 | Ga0415639_078078 | 3300038395 | Bacteria | 1974 |
| 26 | Ga0415639_117686 | 3300038395 | Bacteria | 2129 |
| 27 | Ga0466656_194335 | 3300042550 | Bacteria | 1186 |
| 28 | Ga0466699_210793 | 3300042597 | Bacteria | 2801 |
| 29 | Ga0466726_125853 | 3300042619 | Bacteria | 7815 |
| 30 | Ga0466702_046380 | 3300042635 | Bacteria | 1461 |
| 31 | Ga0466702_141512 | 3300042635 | Unclassified | 1045 |
| 32 | Ga0123357_10054524 | 3300009784 | Bacteria | 5389 |
| 33 | Ga0123357_10088730 | 3300009784 | Bacteria | 4039 |
| 34 | Ga0123356_10698086 | 3300010049 | Bacteria | 1184 |
| 35 | Ga0123353_10286056 | 3300010167 | Bacteria | 2528 |
| 36 | JGI24695J34938_10000424 | 3300002450 | Bacteria | 40819 |
| 37 | JGI24695J34938_10078886 | 3300002450 | Unclassified | 1363 |
| 38 | JGI24702J35022_10925828 | 3300002462 | Bacteria | 543 |
| 39 | Ga0466706_067758 | 3300042599 | Bacteria | 37640 |
| 40 | Ga0466706_262595 | 3300042599 | Bacteria | 4406 |
| 41 | Ga0466713_003867 | 3300042602 | Bacteria | 2180 |
| 42 | Ga0466714_101031 | 3300042603 | Bacteria | 79046 |
| 43 | Ga0466717_219725 | 3300042604 | Unclassified | 1046 |
| 44 | Ga0466716_157301 | 3300042605 | Bacteria | 6875 |
| 45 | Ga0466698_105271 | 3300042610 | Bacteria | 33608 |
| 46 | Ga0466698_279801 | 3300042610 | Bacteria | 1322 |
| 47 | Ga0466733_013347 | 3300042659 | Bacteria | 6976 |
| 48 | Ga0466733_028639 | 3300042659 | Unclassified | 1303 |
| 49 | Ga0466733_048169 | 3300042659 | Bacteria | 3126 |
| 50 | Ga0466733_071083 | 3300042659 | Bacteria | 9797 |
| 51 | Ga0466733_093556 | 3300042659 | Bacteria | 3713 |
| 52 | Ga0265387_1061997 | 3300024582 | Unclassified | 699 |
| 53 | Ga0415639_006963 | 3300038395 | Bacteria | 9614 |
| 54 | Ga0466699_256991 | 3300042597 | Bacteria | 17612 |
| 55 | Ga0466705_519922 | 3300042612 | Bacteria | 6917 |
| 56 | Ga0466711_491881 | 3300042615 | Bacteria | 2562 |
| 57 | Ga0466723_175546 | 3300042618 | Bacteria | 1022 |
| 58 | Ga0466731_384826 | 3300042622 | Bacteria | 2225 |
| 59 | Ga0466708_079679 | 3300042652 | Bacteria | 41277 |
| 60 | Ga0123356_10000028 | 3300010049 | Bacteria | 164875 |
| 61 | Ga0123356_10095138 | 3300010049 | Bacteria | 2847 |
| 62 | Ga0123356_13585956 | 3300010049 | Bacteria | 537 |
| 63 | Ga0123353_10000019 | 3300010167 | Bacteria | 185006 |
| 64 | Ga0123353_10783725 | 3300010167 | Bacteria | 1320 |
| 65 | Ga0123353_11737781 | 3300010167 | Bacteria | 779 |
| 66 | Ga0123354_10307120 | 3300010882 | Bacteria | 1489 |
| 67 | IMNBL1DRAFT_c0049860 | 3300000062 | Bacteria | 1332 |
| 68 | JGI24695J34938_10022267 | 3300002450 | Bacteria | 3081 |
| 69 | Ga0068305_10736790 | 3300005083 | Bacteria | 2228 |
| 70 | Ga0466706_013322 | 3300042599 | Bacteria | 22899 |
| 71 | Ga0466700_402676 | 3300042600 | Bacteria | 88704 |
| 72 | Ga0466714_134725 | 3300042603 | Unclassified | 1545 |
| 73 | Ga0466719_130653 | 3300042606 | Bacteria | 158630 |
| 74 | Ga0466720_176377 | 3300042607 | Bacteria | 1072 |
| 75 | Ga0123356_10195163 | 3300010049 | Unclassified | 2059 |
| 76 | Ga0123356_11165207 | 3300010049 | Bacteria | 938 |
| 77 | Ga0123356_12953395 | 3300010049 | Bacteria | 594 |
| 78 | Ga0123353_10003138 | 3300010167 | Bacteria | 20743 |
| 79 | Ga0123353_12421873 | 3300010167 | Bacteria | 627 |
| 80 | Ga0123353_13255754 | 3300010167 | Bacteria | 519 |
| 81 | 2227191891 | 2225789004 | Bacteria | 35154 |
| 82 | AustNasuHG_c1000697 | 3300000089 | Bacteria | 11949 |
| 83 | JGI24695J34938_10381861 | 3300002450 | Unclassified | 625 |
| 84 | Ga0072941_1015695 | 3300005201 | Bacteria | 23628 |
| 85 | Ga0105005_1302262 | 3300007505 | Bacteria | 1012 |
| 86 | Ga0466713_092327 | 3300042602 | Bacteria | 48279 |
| 87 | Ga0466714_035770 | 3300042603 | Unclassified | 1895 |
| 88 | Ga0466714_052822 | 3300042603 | Bacteria | 4615 |
| 89 | Ga0466714_088948 | 3300042603 | Bacteria | 1271 |
| 90 | Ga0466714_092590 | 3300042603 | Bacteria | 4148 |
| 91 | Ga0466719_322558 | 3300042606 | Bacteria | 4524 |
| 92 | Ga0466705_079320 | 3300042612 | Bacteria | 80574 |
| 93 | Ga0466705_318976 | 3300042612 | Unclassified | 1813 |
| 94 | Ga0466696_197096 | 3300042596 | Bacteria | 6228 |
| 95 | Ga0466710_419232 | 3300042613 | Bacteria | 6782 |
| 96 | Ga0466712_100338 | 3300042614 | Bacteria | 15027 |
| 97 | Ga0466718_046336 | 3300042617 | Bacteria | 63413 |
| 98 | Ga0466734_004198 | 3300042623 | Bacteria | 1214 |
| 99 | Ga0466702_125533 | 3300042635 | Bacteria | 57100 |
| 100 | Ga0123357_10059279 | 3300009784 | Bacteria | 5137 |
| 101 | Ga0123356_10703415 | 3300010049 | Unclassified | 1180 |
| 102 | Ga0123356_10835874 | 3300010049 | Unclassified | 1092 |
| 103 | Ga0123353_10018232 | 3300010167 | Bacteria | 10368 |
| 104 | Ga0123353_10243706 | 3300010167 | Bacteria | 2790 |
| 105 | Ga0123353_10570534 | 3300010167 | Bacteria | 1626 |
| 106 | Ga0123353_11133083 | 3300010167 | Bacteria | 1035 |
| 107 | Ga0123353_11805246 | 3300010167 | Bacteria | 760 |
| 108 | Ga0123353_12088035 | 3300010167 | Bacteria | 690 |
| 109 | IMNBL1DRAFT_c0162642 | 3300000062 | Bacteria | 569 |
| 110 | Ga0068305_10001287 | 3300005083 | Bacteria | 40663 |
| 111 | Ga0466707_281543 | 3300042601 | Bacteria | 1906 |
| 112 | Ga0466707_375112 | 3300042601 | Bacteria | 17480 |
| 113 | Ga0466714_075336 | 3300042603 | Unclassified | 1849 |
| 114 | Ga0466717_021470 | 3300042604 | Bacteria | 2103 |
| 115 | Ga0466720_037933 | 3300042607 | Bacteria | 27996 |
| 116 | Ga0466705_115521 | 3300042612 | Bacteria | 2357 |
| 117 | Ga0466705_357809 | 3300042612 | Bacteria | 37083 |
| 118 | Ga0466733_119837 | 3300042659 | Bacteria | 2132 |
| 119 | Ga0415639_170651 | 3300038395 | Bacteria | 6762 |
| 120 | Ga0466692_120097 | 3300042591 | Bacteria | 76506 |
| 121 | Ga0466715_329238 | 3300042616 | Bacteria | 3036 |
| 122 | Ga0466726_214965 | 3300042619 | Bacteria | 31160 |
| 123 | Ga0466734_128146 | 3300042623 | Bacteria | 1284 |
| 124 | Ga0466735_005075 | 3300042624 | Bacteria | 1848 |
| 125 | Ga0466702_396344 | 3300042635 | Bacteria | 2258 |
| 126 | Ga0466703_349078 | 3300042636 | Bacteria | 2227 |
| 127 | Ga0466704_025574 | 3300042643 | Bacteria | 55023 |
| 128 | Ga0123357_10575354 | 3300009784 | Bacteria | 881 |
| 129 | Ga0123355_10026940 | 3300009826 | Bacteria | 9279 |
| 130 | Ga0123356_10000763 | 3300010049 | Bacteria | 35616 |
| 131 | Ga0123356_10341477 | 3300010049 | Bacteria | 1618 |
| 132 | Ga0123353_12695797 | 3300010167 | Bacteria | 585 |
| 133 | Ga0123354_10496124 | 3300010882 | Bacteria | 955 |
| 134 | JGI24698J34947_10023752 | 3300002449 | Unclassified | 3278 |
| 135 | JGI24705J35276_12238808 | 3300002504 | Bacteria | 121301 |
| 136 | JGI24699J35502_10945964 | 3300002509 | Bacteria | 1159 |
| 137 | Ga0466706_284767 | 3300042599 | Bacteria | 1263 |
| 138 | Ga0466714_046049 | 3300042603 | Unclassified | 1446 |
| 139 | Ga0466717_035673 | 3300042604 | Bacteria | 3668 |
| 140 | Ga0466716_160113 | 3300042605 | Bacteria | 1023 |
| 141 | Ga0466733_131750 | 3300042659 | Bacteria | 3083 |
| 142 | Ga0466733_174298 | 3300042659 | Unclassified | 1388 |
| 143 | Ga0415639_026077 | 3300038395 | Bacteria | 21089 |
| 144 | Ga0466657_371178 | 3300042582 | Bacteria | 21430 |
| 145 | Ga0466691_071505 | 3300042593 | Bacteria | 23482 |
| 146 | Ga0466715_430157 | 3300042616 | Bacteria | 1768 |
| 147 | Ga0466726_195176 | 3300042619 | Bacteria | 1007 |
| 148 | Ga0466726_452480 | 3300042619 | Bacteria | 13818 |
| 149 | Ga0466729_073087 | 3300042621 | Bacteria | 1374 |
| 150 | Ga0466702_111134 | 3300042635 | Bacteria | 1140 |
| 151 | Ga0123355_12111054 | 3300009826 | Bacteria | 518 |
| 152 | Ga0123353_10221232 | 3300010167 | Bacteria | 2960 |
| 153 | Ga0123354_10096403 | 3300010882 | Bacteria | 4041 |
| 154 | JGI24702J35022_10010130 | 3300002462 | Bacteria | 5277 |
| 155 | JGI24696J40584_12408126 | 3300002834 | Bacteria | 558 |
| 156 | Ga0068305_10646888 | 3300005083 | Bacteria | 642 |
| 157 | Ga0072941_1032250 | 3300005201 | Bacteria | 17989 |
| 158 | Ga0466714_077489 | 3300042603 | Bacteria | 2518 |
| 159 | Ga0466721_235909 | 3300042608 | Bacteria | 27576 |
| 160 | Ga0466733_003819 | 3300042659 | Bacteria | 23682 |
| 161 | Ga0265387_1131106 | 3300024582 | Bacteria | 551 |
| 162 | Ga0466692_130735 | 3300042591 | Bacteria | 26218 |
| 163 | Ga0466705_411844 | 3300042612 | Bacteria | 13683 |
| 164 | Ga0466715_509206 | 3300042616 | Bacteria | 1606 |
| 165 | Ga0466734_110705 | 3300042623 | Bacteria | 1692 |
| 166 | Ga0466704_448187 | 3300042643 | Bacteria | 10130 |
| 167 | Ga0466727_054865 | 3300042655 | Bacteria | 148022 |
| 168 | Ga0123357_10412482 | 3300009784 | Bacteria | 1215 |
| 169 | Ga0123355_10765329 | 3300009826 | Bacteria | 1087 |
| 170 | Ga0123353_10009458 | 3300010167 | Bacteria | 13466 |
| 171 | Ga0123353_10025534 | 3300010167 | Bacteria | 9003 |
| 172 | Ga0123353_10631339 | 3300010167 | Bacteria | 1522 |
| 173 | Ga0123353_12130583 | 3300010167 | Unclassified | 681 |
| 174 | JGI24696J40584_12783247 | 3300002834 | Unclassified | 840 |
| 175 | Ga0466698_174739 | 3300042610 | Bacteria | 1953 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00203 | Ribosomal_S19 | Ribosomal protein S19 | 3 | 86 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.