Protein Family IF01940
Metagenome
Isolate
312
Members
246
Samples
121
Scaffolds
247.65
Avg Length
Representative Sequence
- ID
- 3300007224|Ga0104147_1086229|Ga0104147_10862293
- Length
- 282 aa
- Sequence
- XCGLCYAACPQFGLNPELIGPAAITLEKLRLRIRRRRPMAEMQTHKVSIMRYSPETDSEPHNVTYDVPFDEQTSLLDALXXXDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLREYPEGMQVSPLANFPIERDLVVDMTHFIESLEAIKPYIIGNERPLSEGPNTQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNLDNRDRGKAARMPQLNGKNGVWSCTFVGFCSVVCPKHVDPAAAIQQGKVESSKDFLIATLKPR*
Sample Types
Isolate
61.2%
Metagenome
38.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.8%
Drosophilidae
6.0%
Anthocoridae
6.0%
Muscidae
5.6%
Kalotermitidae
5.6%
Termitidae
4.3%
Curculionidae
4.3%
Calliphoridae
3.8%
Tenebrionidae
3.8%
Elmidae
3.4%
Culicidae
2.1%
Termopsidae
1.7%
Cerambycidae
1.7%
Palinuridae
1.3%
Armadillidiidae
1.3%
Talitridae
1.3%
Apidae
1.3%
Tephritidae
1.3%
Sarcophagidae
0.9%
Rhinotermitidae
0.9%
Pentatomidae
0.9%
Passalidae
0.9%
Formicidae
0.9%
Majidae
0.9%
Scarabaeidae
0.4%
Ceratophyllidae
0.4%
Nephropidae
0.4%
Daphniidae
0.4%
Rhopalidae
0.4%
Penaeidae
0.4%
Reduviidae
0.4%
Plutellidae
0.4%
Carabidae
0.4%
Siricidae
0.4%
Crambidae
0.4%
Anthomyiidae
0.4%
Artemiidae
0.4%
Pteromalidae
0.4%
Aphididae
0.4%
Taxonomy
Archaea
0
Bacteria
281
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 2 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 3 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 4 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 5 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 6 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 7 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 8 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 9 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 10 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 11 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 12 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 13 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 14 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300005319 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut | Metagenome | Drosophilidae |
| 17 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 22 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 23 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 24 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 25 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 26 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 27 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 32 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 33 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 34 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 35 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 36 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 37 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 38 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 39 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 40 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 41 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 42 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 43 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 44 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 45 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 46 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 47 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 48 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 49 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 50 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 51 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 52 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 53 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 54 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 55 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 56 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 57 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 58 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 59 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 60 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 61 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 62 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 63 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 64 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 65 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 66 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 67 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 68 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 69 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 70 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 71 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 72 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 73 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 74 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 75 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 76 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 77 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 78 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 79 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 80 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 81 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 82 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 83 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 84 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 85 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 86 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 87 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 88 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 89 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 90 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 91 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 92 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 93 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 94 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 95 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 96 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 97 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 98 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 99 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 100 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 101 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 102 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 103 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 104 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 105 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 106 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 107 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 108 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 109 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 110 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 111 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 112 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 113 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 114 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 115 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 116 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 117 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 118 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 119 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 120 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 121 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 122 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 123 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 124 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 125 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 126 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 127 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 128 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 129 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 130 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 131 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 132 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 133 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 134 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 135 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 136 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 137 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 138 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 139 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 140 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 141 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 142 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 143 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 144 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 145 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 146 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 147 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 148 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 149 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 150 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 151 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 152 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 153 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 154 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 155 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 156 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 157 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 158 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 159 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 160 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 161 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 162 | 2958255616 | Serratia marcescens TM | Isolate | |
| 163 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 164 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 165 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 166 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 167 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 168 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 169 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 170 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 171 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 172 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 173 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 174 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 175 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 176 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 177 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 178 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 179 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 180 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 181 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 182 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 183 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 184 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 185 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 186 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 187 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 188 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 189 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 190 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 191 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 192 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 193 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 194 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 195 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 196 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 197 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 198 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 199 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 200 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 201 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 202 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 203 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 204 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 205 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 206 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 207 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 208 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 209 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 210 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 211 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 212 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 213 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 214 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 215 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 216 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 217 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 218 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 219 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 220 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 221 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 222 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 223 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 224 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 225 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 226 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 227 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 228 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 229 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 230 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 231 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 232 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 233 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 234 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 235 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 236 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 237 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 238 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 239 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 240 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 241 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 242 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 243 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 244 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 245 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 246 | 8051551332 | Vibrio vulnificus Vv003 | Isolate |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 2 | Ga0466701_021554 | 3300042598 | Bacteria | 13380 |
| 3 | Ga0466713_072764 | 3300042602 | Bacteria | 60805 |
| 4 | FGTW_contig30416 | 2065487013 | Bacteria | 72901 |
| 5 | Ga0063521_1000592 | 3300003973 | Bacteria | 15266 |
| 6 | Ga0466711_055083 | 3300042615 | Bacteria | 2176 |
| 7 | Ga0466715_121667 | 3300042616 | Bacteria | 1591 |
| 8 | Ga0160445_119397 | 3300012847 | Unclassified | 908 |
| 9 | Ga0466735_017908 | 3300042624 | Bacteria | 1685 |
| 10 | Ga0466730_018530 | 3300042625 | Bacteria | 48750 |
| 11 | Ga0466709_393181 | 3300042648 | Bacteria | 2413 |
| 12 | Ga0466705_137226 | 3300042612 | Bacteria | 6006 |
| 13 | Ga0466705_319558 | 3300042612 | Bacteria | 13187 |
| 14 | Ga0562376_0001 | 3300056857 | Bacteria | 4828905 |
| 15 | Ga0466713_068412 | 3300042602 | Bacteria | 23498 |
| 16 | Ga0466716_144776 | 3300042605 | Bacteria | 68361 |
| 17 | Ga0063521_1000072 | 3300003973 | Bacteria | 82111 |
| 18 | Ga0068302_10108471 | 3300005071 | Bacteria | 7513 |
| 19 | Ga0074304_1150829 | 3300005319 | Unclassified | 951 |
| 20 | Ga0466705_462089 | 3300042612 | Unclassified | 1587 |
| 21 | Ga0466711_157850 | 3300042615 | Bacteria | 16183 |
| 22 | Ga0466692_003941 | 3300042591 | Bacteria | 4676 |
| 23 | Ga0466730_078956 | 3300042625 | Bacteria | 24539 |
| 24 | Ga0466703_157200 | 3300042636 | Unclassified | 3393 |
| 25 | Ga0466724_35933 | 3300042649 | Unclassified | 19785 |
| 26 | Ga0466727_344869 | 3300042655 | Bacteria | 4326 |
| 27 | Ga0562377_0187 | 3300056842 | Bacteria | 162775 |
| 28 | Ga0466707_049002 | 3300042601 | Unclassified | 3262 |
| 29 | Ga0466707_294185 | 3300042601 | Bacteria | 5470 |
| 30 | Ga0466716_156829 | 3300042605 | Unclassified | 4716 |
| 31 | Ga0466719_097768 | 3300042606 | Bacteria | 1749 |
| 32 | Ga0466722_215042 | 3300042609 | Bacteria | 4728 |
| 33 | DPOL_contig18063 | 2035918003 | Unclassified | 10593 |
| 34 | FGTW_contig15305 | 2065487013 | Bacteria | 6857 |
| 35 | 2227563506 | 2225789004 | Bacteria | 52367 |
| 36 | CVPL010L_1000299 | 3300002932 | Unclassified | 25841 |
| 37 | Ga0123356_10379885 | 3300010049 | Bacteria | 1545 |
| 38 | Ga0466710_188303 | 3300042613 | Bacteria | 6004 |
| 39 | Ga0466710_366079 | 3300042613 | Bacteria | 1218 |
| 40 | Ga0466728_225815 | 3300042620 | Bacteria | 6473 |
| 41 | Ga0247289_0096 | 3300035363 | Unclassified | 23439 |
| 42 | Ga0415639_168950 | 3300038395 | Bacteria | 3423 |
| 43 | Ga0466692_024378 | 3300042591 | Bacteria | 43078 |
| 44 | Ga0466696_077999 | 3300042596 | Bacteria | 1524 |
| 45 | Ga0466704_088456 | 3300042643 | Unclassified | 13578 |
| 46 | Ga0466709_252575 | 3300042648 | Bacteria | 26818 |
| 47 | Ga0466708_115264 | 3300042652 | Bacteria | 71386 |
| 48 | Ga0466708_148367 | 3300042652 | Bacteria | 16613 |
| 49 | Ga0466713_106812 | 3300042602 | Bacteria | 58900 |
| 50 | Ga0466716_271034 | 3300042605 | Bacteria | 2036 |
| 51 | CVPL010L_1006072 | 3300002932 | Unclassified | 1197 |
| 52 | Ga0063521_1000019 | 3300003973 | Bacteria | 139495 |
| 53 | Ga0063521_1001400 | 3300003973 | Bacteria | 6704 |
| 54 | Ga0074188_1155091 | 3300005318 | Bacteria | 4318 |
| 55 | Ga0104041_1001062 | 3300007106 | Unclassified | 2280 |
| 56 | Ga0466715_089815 | 3300042616 | Bacteria | 151941 |
| 57 | Ga0466715_123034 | 3300042616 | Unclassified | 1947 |
| 58 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 59 | Ga0466730_024341 | 3300042625 | Bacteria | 15445 |
| 60 | Ga0466704_534571 | 3300042643 | Bacteria | 3684 |
| 61 | Ga0466708_066666 | 3300042652 | Bacteria | 23122 |
| 62 | Ga0466713_080748 | 3300042602 | Unclassified | 6297 |
| 63 | Ga0466719_056832 | 3300042606 | Unclassified | 4884 |
| 64 | Ga0466722_010978 | 3300042609 | Bacteria | 2234 |
| 65 | DPOL_contig14696 | 2035918003 | Unclassified | 8126 |
| 66 | SWWA_contig00430__length_9784___numreads_188 | 2100351016 | Unclassified | 9784 |
| 67 | IMNBL1DRAFT_c0003489 | 3300000062 | Bacteria | 10074 |
| 68 | CVPL010L_1000209 | 3300002932 | Unclassified | 32705 |
| 69 | Ga0068302_10467180 | 3300005071 | Bacteria | 3263 |
| 70 | Ga0466715_123807 | 3300042616 | Bacteria | 1947 |
| 71 | Ga0466735_046305 | 3300042624 | Unclassified | 1857 |
| 72 | Ga0466735_066933 | 3300042624 | Bacteria | 10281 |
| 73 | Ga0466730_028814 | 3300042625 | Unclassified | 3407 |
| 74 | Ga0466730_086486 | 3300042625 | Unclassified | 4387 |
| 75 | Ga0466703_126933 | 3300042636 | Bacteria | 2222 |
| 76 | Ga0466705_141134 | 3300042612 | Unclassified | 5278 |
| 77 | Ga0466705_163147 | 3300042612 | Bacteria | 5991 |
| 78 | Ga0562378_0420 | 3300056814 | Bacteria | 76738 |
| 79 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 80 | Ga0466713_094275 | 3300042602 | Bacteria | 56325 |
| 81 | Ga0466719_294421 | 3300042606 | Unclassified | 1236 |
| 82 | Ga0466719_498108 | 3300042606 | Bacteria | 2635 |
| 83 | Ga0466722_263162 | 3300042609 | Bacteria | 2158 |
| 84 | Ga0063521_1001425 | 3300003973 | Unclassified | 6572 |
| 85 | Ga0104147_1019534 | 3300007224 | Unclassified | 2827 |
| 86 | Ga0105553_1034652 | 3300007767 | Bacteria | 50248 |
| 87 | Ga0466723_013675 | 3300042618 | Bacteria | 13164 |
| 88 | Ga0466726_300531 | 3300042619 | Bacteria | 15957 |
| 89 | Ga0466657_188314 | 3300042582 | Bacteria | 1344 |
| 90 | Ga0466734_115459 | 3300042623 | Bacteria | 3294 |
| 91 | Ga0466703_227664 | 3300042636 | Bacteria | 8216 |
| 92 | Ga0466733_007222 | 3300042659 | Bacteria | 10462 |
| 93 | Ga0466716_248259 | 3300042605 | Bacteria | 24382 |
| 94 | DPO_contig01334 | 2032320009 | Unclassified | 4411 |
| 95 | Meta3P_1000274 | 3300002464 | Unclassified | 16806 |
| 96 | Ga0104042_1034796 | 3300007130 | Bacteria | 5788 |
| 97 | Ga0127645_122394 | 3300009461 | Bacteria | 2622 |
| 98 | Ga0123353_10699633 | 3300010167 | Bacteria | 1423 |
| 99 | Ga0466710_177719 | 3300042613 | Bacteria | 2030 |
| 100 | Ga0466711_341619 | 3300042615 | Bacteria | 14707 |
| 101 | Ga0160467_100149 | 3300012829 | Bacteria | 99799 |
| 102 | Ga0160433_103355 | 3300012846 | Unclassified | 2918 |
| 103 | Ga0265387_1000020 | 3300024582 | Bacteria | 70273 |
| 104 | Ga0466704_175678 | 3300042643 | Bacteria | 36087 |
| 105 | Ga0466704_181398 | 3300042643 | Bacteria | 9255 |
| 106 | Ga0466709_396489 | 3300042648 | Unclassified | 2141 |
| 107 | Ga0466707_052975 | 3300042601 | Bacteria | 11912 |
| 108 | Ga0466713_045571 | 3300042602 | Bacteria | 4801 |
| 109 | Ga0466713_054015 | 3300042602 | Bacteria | 7770 |
| 110 | Ga0466722_099401 | 3300042609 | Bacteria | 6029 |
| 111 | FGTW_contig31179 | 2065487013 | Bacteria | 5661 |
| 112 | Ga0063521_1000418 | 3300003973 | Bacteria | 22818 |
| 113 | Ga0104147_1086229 | 3300007224 | Bacteria | 3822 |
| 114 | Ga0466726_318234 | 3300042619 | Bacteria | 43596 |
| 115 | Ga0265387_1000547 | 3300024582 | Unclassified | 5930 |
| 116 | Ga0415639_071247 | 3300038395 | Bacteria | 2861 |
| 117 | Ga0466691_048794 | 3300042593 | Bacteria | 13628 |
| 118 | Ga0466696_099985 | 3300042596 | Bacteria | 4009 |
| 119 | Ga0466703_093005 | 3300042636 | Bacteria | 2920 |
| 120 | Ga0466703_200546 | 3300042636 | Bacteria | 3915 |
| 121 | Ga0466709_274234 | 3300042648 | Bacteria | 19600 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13237 | Fer4_10 | 4Fe-4S dicluster domain | 180 | 253 | 0.97 |
| PF13085 | Fer2_3 | 2Fe-2S iron-sulfur cluster binding domain | 46 | 148 | 0.94 |
| PF13534 | Fer4_17 | 4Fe-4S dicluster domain | 186 | 257 | 0.77 |
| PF13484 | Fer4_16 | 4Fe-4S double cluster binding domain | 186 | 254 | 0.72 |
| PF13183 | Fer4_8 | 4Fe-4S dicluster domain | 184 | 256 | 0.67 |
| PF12838 | Fer4_7 | 4Fe-4S dicluster domain | 186 | 255 | 0.62 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.