Protein Family IF01801
Metagenome
Metatranscriptome
Isolate
477
Members
196
Samples
373
Scaffolds
205.26
Avg Length
Representative Sequence
- ID
- 3300007143|Ga0104048_1022915|Ga0104048_10229151
- Length
- 243 aa
- Sequence
- LFDSYKNVCTFAVPYWGKYVLSEALLLRWTLINFIXNMSGIIGKKVGMTSLFNADGKNIPCTVIEAGPCVVTQIRTVEKDGYSAIQLGYDDAKEKNTSAPLKGHFAKAGVAPKRKLVEFKTFEDEKQLGDTIDVTLFAEGEFVDVVGTSKGKGFQGVMKRHGFGGVGGATHGQHNRLRAPGSIGAASWPSRVFKGMRMAGRMGGDRVKVQNLQVLKVYADKNLIVVSGSIPGAKGSYVILDK*
Sample Types
Isolate
21.8%
Metagenome
77.8%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
20.8%
Unclassified
13.1%
Apidae
13.1%
Blattidae
11.5%
Kalotermitidae
7.7%
Formicidae
5.5%
Elmidae
4.9%
Culicidae
3.3%
Rhinotermitidae
2.7%
Tenebrionidae
2.2%
Passalidae
2.2%
Armadillidiidae
2.2%
Drosophilidae
2.2%
Termopsidae
1.6%
Pseudophyllodromiidae
1.1%
Cambaridae
1.1%
Hodotermitidae
0.5%
Hydrophilidae
0.5%
Tryonicidae
0.5%
Daphniidae
0.5%
Blattellidae
0.5%
Aphididae
0.5%
Bombycidae
0.5%
Kiwaidae
0.5%
Nephropidae
0.5%
Taxonomy
Archaea
0
Bacteria
435
Eukaryota
0
Viruses
0
Unclassified
42
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 2 | 2820935937 | Unclassified Actinobacteria Emb289P1bin40 | Isolate | Unclassified |
| 3 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 4 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 5 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 6 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 7 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 8 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 9 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 10 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 11 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 12 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 13 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 14 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 17 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 18 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 19 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 20 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 24 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 29 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 37 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 38 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 39 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 40 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 41 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 42 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 43 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 46 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 47 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 48 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 49 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 50 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 51 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 52 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 53 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 54 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 55 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 56 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 57 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 58 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 59 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 60 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 61 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 62 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 63 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 64 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 65 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 66 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 67 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 68 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 69 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 70 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 71 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 72 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 73 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 74 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 75 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 76 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 77 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 78 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 79 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 80 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 81 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 82 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 83 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 84 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 85 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 86 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 87 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 88 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 89 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 90 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 91 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 92 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 93 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 94 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 95 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 96 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 97 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 98 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 99 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 100 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 101 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 102 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 103 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 104 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 105 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 106 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 107 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 108 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 109 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 110 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 111 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 112 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 113 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 114 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 115 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 116 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 117 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 118 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 119 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 120 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 121 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 122 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 123 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 124 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 125 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 126 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 127 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 128 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 129 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 130 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 131 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 132 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 133 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 134 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 135 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 136 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 137 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 138 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 139 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 140 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 141 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 142 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 143 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 144 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 145 | 2820193510 | Unclassified Planctomycetes Emb289P3bin83 | Isolate | Unclassified |
| 146 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 147 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 148 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 149 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 150 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 151 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 152 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 153 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 154 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 155 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 156 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 157 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 158 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 159 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 160 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 161 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 162 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 163 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 164 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 165 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 166 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 167 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 168 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 169 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 170 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 171 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 172 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 173 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 174 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 175 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 176 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 177 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 178 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 179 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 180 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 181 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 182 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 183 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 184 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 185 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 186 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 187 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 188 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 189 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 190 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 191 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 192 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 193 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 194 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 195 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 196 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_254462 | 3300042611 | Bacteria | 3974 |
| 2 | Ga0466732_187289 | 3300042656 | Bacteria | 8588 |
| 3 | Ga0466710_082075 | 3300042613 | Bacteria | 1736 |
| 4 | Ga0466710_094406 | 3300042613 | Bacteria | 4573 |
| 5 | Ga0466715_324314 | 3300042616 | Bacteria | 25350 |
| 6 | Ga0466715_440169 | 3300042616 | Bacteria | 7303 |
| 7 | Ga0466718_033913 | 3300042617 | Bacteria | 1690 |
| 8 | Ga0466723_039697 | 3300042618 | Bacteria | 34610 |
| 9 | Ga0466726_127696 | 3300042619 | Bacteria | 2093 |
| 10 | Ga0123355_10616763 | 3300009826 | Bacteria | 1280 |
| 11 | Ga0123356_10038853 | 3300010049 | Bacteria | 4435 |
| 12 | Ga0123356_10443960 | 3300010049 | Unclassified | 1444 |
| 13 | Ga0123356_10587402 | 3300010049 | Unclassified | 1278 |
| 14 | Ga0123356_11261484 | 3300010049 | Bacteria | 903 |
| 15 | Ga0466706_236050 | 3300042599 | Bacteria | 32404 |
| 16 | Ga0466700_260085 | 3300042600 | Bacteria | 4561 |
| 17 | Ga0466714_001616 | 3300042603 | Bacteria | 2014 |
| 18 | Ga0466714_060371 | 3300042603 | Bacteria | 4072 |
| 19 | Ga0466719_046736 | 3300042606 | Bacteria | 2388 |
| 20 | Ga0466719_052800 | 3300042606 | Bacteria | 24279 |
| 21 | Ga0466719_166530 | 3300042606 | Bacteria | 1652 |
| 22 | Ga0466722_117304 | 3300042609 | Bacteria | 122884 |
| 23 | Ga0466722_240663 | 3300042609 | Bacteria | 5357 |
| 24 | Ga0466731_432274 | 3300042622 | Bacteria | 26425 |
| 25 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 26 | Ga0466703_174375 | 3300042636 | Bacteria | 10269 |
| 27 | Ga0466704_300588 | 3300042643 | Bacteria | 28806 |
| 28 | Ga0466709_170238 | 3300042648 | Bacteria | 55916 |
| 29 | Ga0466727_189400 | 3300042655 | Bacteria | 6811 |
| 30 | Ga0466727_347932 | 3300042655 | Unclassified | 9129 |
| 31 | Ga0160453_100102 | 3300012814 | Bacteria | 86683 |
| 32 | Ga0160440_101303 | 3300012815 | Bacteria | 3422 |
| 33 | Ga0466656_134754 | 3300042550 | Bacteria | 1657 |
| 34 | Ga0466657_092354 | 3300042582 | Unclassified | 1183 |
| 35 | Ga0466690_127981 | 3300042590 | Bacteria | 4869 |
| 36 | Ga0466690_156024 | 3300042590 | Unclassified | 2950 |
| 37 | Ga0466694_029085 | 3300042594 | Bacteria | 4223 |
| 38 | IMNBL1DRAFT_c0000355 | 3300000062 | Bacteria | 38787 |
| 39 | HBC_ctgsDRAFT_1000803 | 3300000333 | Bacteria | 6942 |
| 40 | JGI24695J34938_10028755 | 3300002450 | Unclassified | 2607 |
| 41 | JGI24702J35022_10000547 | 3300002462 | Bacteria | 22726 |
| 42 | JGI24702J35022_10020610 | 3300002462 | Bacteria | 3577 |
| 43 | Ga0072940_1195138 | 3300005200 | Bacteria | 2658 |
| 44 | Ga0072941_1782216 | 3300005201 | Bacteria | 860 |
| 45 | Ga0104043_1000265 | 3300007058 | Bacteria | 2507 |
| 46 | Ga0466697_199457 | 3300042611 | Bacteria | 1049 |
| 47 | Ga0466705_038128 | 3300042612 | Bacteria | 49408 |
| 48 | Ga0466727_352642 | 3300042655 | Bacteria | 45291 |
| 49 | Ga0466733_010991 | 3300042659 | Bacteria | 23768 |
| 50 | Ga0466726_284088 | 3300042619 | Bacteria | 8137 |
| 51 | Ga0466728_371296 | 3300042620 | Bacteria | 1876 |
| 52 | Ga0123356_10070678 | 3300010049 | Bacteria | 3274 |
| 53 | Ga0123356_10190054 | 3300010049 | Bacteria | 2083 |
| 54 | Ga0123356_10453019 | 3300010049 | Bacteria | 1432 |
| 55 | Ga0123353_10336852 | 3300010167 | Bacteria | 2281 |
| 56 | Ga0123354_10117877 | 3300010882 | Unclassified | 3451 |
| 57 | Ga0466706_108974 | 3300042599 | Bacteria | 3494 |
| 58 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 59 | Ga0466706_177219 | 3300042599 | Bacteria | 25525 |
| 60 | Ga0466707_152952 | 3300042601 | Bacteria | 15357 |
| 61 | Ga0466714_059082 | 3300042603 | Bacteria | 46712 |
| 62 | Ga0466716_483438 | 3300042605 | Bacteria | 16673 |
| 63 | Ga0466719_142182 | 3300042606 | Bacteria | 6280 |
| 64 | Ga0466722_238842 | 3300042609 | Bacteria | 1274 |
| 65 | Ga0466731_050866 | 3300042622 | Bacteria | 13115 |
| 66 | Ga0466735_167072 | 3300042624 | Bacteria | 3260 |
| 67 | Ga0466704_441700 | 3300042643 | Bacteria | 20268 |
| 68 | Ga0466704_442514 | 3300042643 | Bacteria | 75471 |
| 69 | Ga0466704_472759 | 3300042643 | Bacteria | 20123 |
| 70 | Ga0160467_100137 | 3300012829 | Bacteria | 102655 |
| 71 | Ga0255786_1037527 | 3300022815 | Bacteria | 1506 |
| 72 | Ga0466657_050226 | 3300042582 | Bacteria | 1378 |
| 73 | Ga0466657_203358 | 3300042582 | Bacteria | 5969 |
| 74 | Ga0466690_408102 | 3300042590 | Bacteria | 19917 |
| 75 | Ga0466693_216672 | 3300042592 | Bacteria | 7681 |
| 76 | Ga0466696_451317 | 3300042596 | Bacteria | 5474 |
| 77 | Ga0466699_089256 | 3300042597 | Bacteria | 4669 |
| 78 | IMNBL1DRAFT_c0019749 | 3300000062 | Bacteria | 2750 |
| 79 | IMNBL1DRAFT_c0087193 | 3300000062 | Bacteria | 862 |
| 80 | AustNasuHG_c1039401 | 3300000089 | Unclassified | 1174 |
| 81 | JGI24705J35276_11994651 | 3300002504 | Bacteria | 841 |
| 82 | JGI24705J35276_12224607 | 3300002504 | Unclassified | 2628 |
| 83 | JGI24696J40584_12937071 | 3300002834 | Bacteria | 1594 |
| 84 | Ga0104045_1079210 | 3300007085 | Bacteria | 1314 |
| 85 | Ga0102734_1000004 | 3300007129 | Bacteria | 74698 |
| 86 | Ga0104019_1005093 | 3300007150 | Unclassified | 3724 |
| 87 | Ga0466697_139692 | 3300042611 | Bacteria | 246544 |
| 88 | Ga0466705_111418 | 3300042612 | Bacteria | 19183 |
| 89 | Ga0466727_349423 | 3300042655 | Bacteria | 30219 |
| 90 | Ga0466733_003059 | 3300042659 | Bacteria | 1955 |
| 91 | Ga0466733_071083 | 3300042659 | Bacteria | 9797 |
| 92 | Ga0466712_048491 | 3300042614 | Bacteria | 3005 |
| 93 | Ga0466711_095236 | 3300042615 | Bacteria | 15743 |
| 94 | Ga0466715_016519 | 3300042616 | Bacteria | 9108 |
| 95 | Ga0466715_025469 | 3300042616 | Bacteria | 20577 |
| 96 | Ga0466715_399980 | 3300042616 | Bacteria | 10325 |
| 97 | Ga0466726_433375 | 3300042619 | Bacteria | 1229 |
| 98 | Ga0123356_10016275 | 3300010049 | Bacteria | 7101 |
| 99 | Ga0123356_10086245 | 3300010049 | Bacteria | 2980 |
| 100 | Ga0123356_10551552 | 3300010049 | Bacteria | 1314 |
| 101 | Ga0123353_10254171 | 3300010167 | Unclassified | 2719 |
| 102 | Ga0466706_154978 | 3300042599 | Bacteria | 125008 |
| 103 | Ga0466714_047386 | 3300042603 | Unclassified | 1178 |
| 104 | Ga0466717_225860 | 3300042604 | Bacteria | 3649 |
| 105 | Ga0466716_248006 | 3300042605 | Bacteria | 34292 |
| 106 | Ga0466722_062905 | 3300042609 | Bacteria | 4977 |
| 107 | Ga0466734_061444 | 3300042623 | Bacteria | 1388 |
| 108 | Ga0466735_115736 | 3300042624 | Bacteria | 1702 |
| 109 | Ga0466735_230617 | 3300042624 | Unclassified | 3485 |
| 110 | Ga0466703_135901 | 3300042636 | Bacteria | 6825 |
| 111 | Ga0466704_601523 | 3300042643 | Bacteria | 55044 |
| 112 | Ga0466709_060190 | 3300042648 | Bacteria | 23292 |
| 113 | Ga0466724_19778 | 3300042649 | Bacteria | 13457 |
| 114 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 115 | Ga0466708_254314 | 3300042652 | Bacteria | 24323 |
| 116 | Ga0466725_008954 | 3300042654 | Bacteria | 7244 |
| 117 | Ga0466725_037990 | 3300042654 | Bacteria | 18222 |
| 118 | Ga0160432_100014 | 3300012818 | Bacteria | 330009 |
| 119 | Ga0160467_103080 | 3300012829 | Bacteria | 3057 |
| 120 | Ga0160443_101956 | 3300012848 | Bacteria | 5442 |
| 121 | Ga0415639_006963 | 3300038395 | Bacteria | 9614 |
| 122 | Ga0466657_117669 | 3300042582 | Bacteria | 4883 |
| 123 | Ga0466694_341837 | 3300042594 | Bacteria | 11347 |
| 124 | Ga0466694_383842 | 3300042594 | Bacteria | 2185 |
| 125 | Ga0466696_292634 | 3300042596 | Bacteria | 17358 |
| 126 | Ga0466699_089667 | 3300042597 | Bacteria | 2475 |
| 127 | Ga0466699_091901 | 3300042597 | Bacteria | 5201 |
| 128 | 2227287203 | 2225789004 | Bacteria | 1247 |
| 129 | IMNBL1DRAFT_c0009048 | 3300000062 | Bacteria | 4989 |
| 130 | IMNBL1DRAFT_c0049278 | 3300000062 | Bacteria | 1344 |
| 131 | JGI24695J34938_10001239 | 3300002450 | Bacteria | 22470 |
| 132 | JGI24702J35022_10036259 | 3300002462 | Bacteria | 2636 |
| 133 | JGI24702J35022_10127233 | 3300002462 | Bacteria | 1412 |
| 134 | JGI24696J40584_12766744 | 3300002834 | Bacteria | 815 |
| 135 | Ga0072941_1102374 | 3300005201 | Bacteria | 13675 |
| 136 | Ga0102736_1000046 | 3300007052 | Bacteria | 35527 |
| 137 | Ga0104043_1000559 | 3300007058 | Bacteria | 2646 |
| 138 | Ga0466732_375693 | 3300042656 | Bacteria | 1032 |
| 139 | Ga0466733_050026 | 3300042659 | Bacteria | 5614 |
| 140 | Ga0466733_143508 | 3300042659 | Bacteria | 1162 |
| 141 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 142 | Ga0466710_047078 | 3300042613 | Bacteria | 1764 |
| 143 | Ga0466710_109214 | 3300042613 | Unclassified | 1120 |
| 144 | Ga0466711_139501 | 3300042615 | Bacteria | 14201 |
| 145 | Ga0466711_312679 | 3300042615 | Bacteria | 3526 |
| 146 | Ga0466715_275548 | 3300042616 | Bacteria | 29682 |
| 147 | Ga0466726_375469 | 3300042619 | Bacteria | 5040 |
| 148 | Ga0123356_10042349 | 3300010049 | Bacteria | 4242 |
| 149 | Ga0123356_10421345 | 3300010049 | Bacteria | 1477 |
| 150 | Ga0123353_10479090 | 3300010167 | Bacteria | 1821 |
| 151 | Ga0123353_10878094 | 3300010167 | Bacteria | 1224 |
| 152 | Ga0123353_11299149 | 3300010167 | Bacteria | 945 |
| 153 | Ga0123353_11331768 | 3300010167 | Bacteria | 929 |
| 154 | Ga0123354_10035685 | 3300010882 | Bacteria | 7765 |
| 155 | Ga0123354_10060830 | 3300010882 | Bacteria | 5580 |
| 156 | Ga0466706_098228 | 3300042599 | Bacteria | 39742 |
| 157 | Ga0466706_130283 | 3300042599 | Bacteria | 1561 |
| 158 | Ga0466700_294269 | 3300042600 | Bacteria | 1443 |
| 159 | Ga0466707_025096 | 3300042601 | Bacteria | 11103 |
| 160 | Ga0466713_052484 | 3300042602 | Bacteria | 51192 |
| 161 | Ga0466716_164327 | 3300042605 | Bacteria | 8854 |
| 162 | Ga0466716_397647 | 3300042605 | Bacteria | 6519 |
| 163 | Ga0466719_218070 | 3300042606 | Bacteria | 19356 |
| 164 | Ga0466719_221803 | 3300042606 | Unclassified | 1741 |
| 165 | Ga0466698_273829 | 3300042610 | Bacteria | 4454 |
| 166 | Ga0466698_310478 | 3300042610 | Bacteria | 2184 |
| 167 | Ga0466731_277187 | 3300042622 | Unclassified | 1582 |
| 168 | Ga0466731_361059 | 3300042622 | Bacteria | 1037 |
| 169 | Ga0466735_037964 | 3300042624 | Bacteria | 1173 |
| 170 | Ga0466735_186444 | 3300042624 | Bacteria | 1629 |
| 171 | Ga0466703_374219 | 3300042636 | Bacteria | 24808 |
| 172 | Ga0466704_200902 | 3300042643 | Bacteria | 34955 |
| 173 | Ga0466709_400546 | 3300042648 | Bacteria | 20980 |
| 174 | Ga0466724_68479 | 3300042649 | Bacteria | 2255 |
| 175 | Ga0466727_317519 | 3300042655 | Unclassified | 2105 |
| 176 | Ga0160431_100882 | 3300012828 | Bacteria | 9728 |
| 177 | Ga0160459_106080 | 3300012831 | Bacteria | 1551 |
| 178 | Ga0466656_349989 | 3300042550 | Bacteria | 1343 |
| 179 | Ga0466657_248015 | 3300042582 | Bacteria | 2997 |
| 180 | Ga0466657_329870 | 3300042582 | Bacteria | 1192 |
| 181 | Ga0466690_170288 | 3300042590 | Bacteria | 25098 |
| 182 | Ga0466690_285786 | 3300042590 | Bacteria | 5108 |
| 183 | Ga0466693_027197 | 3300042592 | Bacteria | 1493 |
| 184 | Ga0466695_019243 | 3300042595 | Bacteria | 4125 |
| 185 | Ga0466696_398980 | 3300042596 | Bacteria | 15504 |
| 186 | 2227005082 | 2225789003 | Unclassified | 1243 |
| 187 | IMNBL1DRAFT_c0004523 | 3300000062 | Unclassified | 8312 |
| 188 | Meta3P_1002969 | 3300002464 | Bacteria | 8316 |
| 189 | Ga0068305_10037372 | 3300005083 | Bacteria | 1214 |
| 190 | Ga0104045_1018397 | 3300007085 | Unclassified | 3655 |
| 191 | Ga0104048_1022915 | 3300007143 | Bacteria | 2377 |
| 192 | Ga0466733_122413 | 3300042659 | Bacteria | 26318 |
| 193 | Ga0530661_000396 | 3300056564 | Bacteria | 32681 |
| 194 | Ga0466705_502095 | 3300042612 | Bacteria | 14372 |
| 195 | Ga0466710_233188 | 3300042613 | Bacteria | 1200 |
| 196 | Ga0466723_184116 | 3300042618 | Bacteria | 30069 |
| 197 | Ga0466723_299798 | 3300042618 | Bacteria | 46375 |
| 198 | Ga0466726_468513 | 3300042619 | Bacteria | 3456 |
| 199 | Ga0123355_10038353 | 3300009826 | Unclassified | 7790 |
| 200 | Ga0123353_10017059 | 3300010167 | Bacteria | 10648 |
| 201 | Ga0123354_10203778 | 3300010882 | Bacteria | 2164 |
| 202 | Ga0466707_194386 | 3300042601 | Bacteria | 27039 |
| 203 | Ga0466707_304149 | 3300042601 | Bacteria | 15511 |
| 204 | Ga0466713_016510 | 3300042602 | Bacteria | 4309 |
| 205 | Ga0466713_064315 | 3300042602 | Bacteria | 5117 |
| 206 | Ga0466713_071914 | 3300042602 | Bacteria | 7791 |
| 207 | Ga0466713_145538 | 3300042602 | Bacteria | 1173 |
| 208 | Ga0466714_150817 | 3300042603 | Bacteria | 1833 |
| 209 | Ga0466717_084799 | 3300042604 | Bacteria | 6624 |
| 210 | Ga0466717_089921 | 3300042604 | Bacteria | 1646 |
| 211 | Ga0466719_041964 | 3300042606 | Bacteria | 13223 |
| 212 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 213 | Ga0466722_088834 | 3300042609 | Bacteria | 20099 |
| 214 | Ga0466722_143981 | 3300042609 | Bacteria | 20003 |
| 215 | Ga0466735_216908 | 3300042624 | Bacteria | 3045 |
| 216 | Ga0466735_234592 | 3300042624 | Bacteria | 1738 |
| 217 | Ga0466702_172546 | 3300042635 | Bacteria | 1216 |
| 218 | Ga0466703_115413 | 3300042636 | Bacteria | 35262 |
| 219 | Ga0466703_241993 | 3300042636 | Bacteria | 19818 |
| 220 | Ga0466703_279649 | 3300042636 | Bacteria | 29017 |
| 221 | Ga0466703_370511 | 3300042636 | Bacteria | 9254 |
| 222 | Ga0466709_129005 | 3300042648 | Bacteria | 13583 |
| 223 | Ga0466709_356044 | 3300042648 | Bacteria | 4031 |
| 224 | Ga0466708_076108 | 3300042652 | Bacteria | 112124 |
| 225 | Ga0466708_147523 | 3300042652 | Bacteria | 9393 |
| 226 | Ga0160457_1028897 | 3300012858 | Bacteria | 766 |
| 227 | Ga0157631_112806 | 3300013007 | Bacteria | 3277 |
| 228 | Ga0466657_244592 | 3300042582 | Bacteria | 1041 |
| 229 | Ga0466690_136026 | 3300042590 | Bacteria | 11620 |
| 230 | Ga0466692_161873 | 3300042591 | Bacteria | 51547 |
| 231 | Ga0466691_015234 | 3300042593 | Bacteria | 46974 |
| 232 | Ga0466694_014150 | 3300042594 | Unclassified | 1465 |
| 233 | Ga0466695_263502 | 3300042595 | Unclassified | 1061 |
| 234 | Ga0466696_435368 | 3300042596 | Bacteria | 7439 |
| 235 | Ga0466699_169927 | 3300042597 | Unclassified | 1192 |
| 236 | Ga0466699_212185 | 3300042597 | Bacteria | 4280 |
| 237 | 2227197475 | 2225789004 | Bacteria | 7808 |
| 238 | 2227505183 | 2225789004 | Bacteria | 18874 |
| 239 | Ga0068305_10010112 | 3300005083 | Bacteria | 17726 |
| 240 | Ga0072941_1039792 | 3300005201 | Bacteria | 16891 |
| 241 | Ga0127649_100060 | 3300009460 | Bacteria | 50841 |
| 242 | Ga0466697_182528 | 3300042611 | Bacteria | 3217 |
| 243 | Ga0466705_092258 | 3300042612 | Bacteria | 6924 |
| 244 | Ga0466705_110389 | 3300042612 | Bacteria | 3840 |
| 245 | Ga0466732_417324 | 3300042656 | Bacteria | 5519 |
| 246 | Ga0466733_086104 | 3300042659 | Unclassified | 1714 |
| 247 | Ga0562376_3916 | 3300056857 | Unclassified | 13797 |
| 248 | Ga0466710_004938 | 3300042613 | Bacteria | 2610 |
| 249 | Ga0466710_016568 | 3300042613 | Unclassified | 1206 |
| 250 | Ga0466710_346069 | 3300042613 | Bacteria | 1499 |
| 251 | Ga0466712_208369 | 3300042614 | Unclassified | 2268 |
| 252 | Ga0466711_052952 | 3300042615 | Bacteria | 10990 |
| 253 | Ga0466711_059282 | 3300042615 | Bacteria | 3140 |
| 254 | Ga0466728_027008 | 3300042620 | Bacteria | 23890 |
| 255 | Ga0466728_292510 | 3300042620 | Bacteria | 40918 |
| 256 | Ga0123356_10006430 | 3300010049 | Bacteria | 11843 |
| 257 | Ga0123353_10116849 | 3300010167 | Bacteria | 4292 |
| 258 | Ga0123353_10147758 | 3300010167 | Bacteria | 3757 |
| 259 | Ga0123353_11155780 | 3300010167 | Bacteria | 1021 |
| 260 | Ga0466701_028122 | 3300042598 | Bacteria | 16664 |
| 261 | Ga0466706_081007 | 3300042599 | Bacteria | 9016 |
| 262 | Ga0466700_181854 | 3300042600 | Unclassified | 1098 |
| 263 | Ga0466707_354355 | 3300042601 | Bacteria | 49155 |
| 264 | Ga0466713_127060 | 3300042602 | Bacteria | 78606 |
| 265 | Ga0466713_137191 | 3300042602 | Bacteria | 44160 |
| 266 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 267 | Ga0466722_026009 | 3300042609 | Bacteria | 11991 |
| 268 | Ga0466698_395311 | 3300042610 | Bacteria | 3177 |
| 269 | Ga0466731_374848 | 3300042622 | Bacteria | 1510 |
| 270 | Ga0466725_058791 | 3300042654 | Bacteria | 5071 |
| 271 | Ga0255809_1087506 | 3300022820 | Unclassified | 882 |
| 272 | Ga0415639_094378 | 3300038395 | Bacteria | 3803 |
| 273 | Ga0415639_186747 | 3300038395 | Bacteria | 2846 |
| 274 | Ga0466657_106754 | 3300042582 | Bacteria | 1533 |
| 275 | Ga0466695_041962 | 3300042595 | Unclassified | 1091 |
| 276 | Ga0466696_007662 | 3300042596 | Bacteria | 4151 |
| 277 | Ga0466696_147649 | 3300042596 | Bacteria | 7322 |
| 278 | Ga0466696_236491 | 3300042596 | Bacteria | 25393 |
| 279 | Ga0466699_097561 | 3300042597 | Bacteria | 1056 |
| 280 | Ga0466699_135310 | 3300042597 | Bacteria | 4484 |
| 281 | Ga0466699_207432 | 3300042597 | Bacteria | 1322 |
| 282 | IMNBL1DRAFT_c0000282 | 3300000062 | Bacteria | 44672 |
| 283 | IMNBL1DRAFT_c0017841 | 3300000062 | Bacteria | 2970 |
| 284 | JGI24702J35022_10039296 | 3300002462 | Bacteria | 2525 |
| 285 | Ga0068305_10005517 | 3300005083 | Bacteria | 12275 |
| 286 | Ga0068305_10015112 | 3300005083 | Bacteria | 28238 |
| 287 | Ga0072941_1370518 | 3300005201 | Bacteria | 1785 |
| 288 | Ga0074278_111360 | 3300005721 | Unclassified | 2917 |
| 289 | Ga0466733_013630 | 3300042659 | Bacteria | 6058 |
| 290 | Ga0466733_020611 | 3300042659 | Bacteria | 2555 |
| 291 | Ga0466705_403255 | 3300042612 | Bacteria | 37741 |
| 292 | Ga0466711_298353 | 3300042615 | Bacteria | 9138 |
| 293 | Ga0466715_119604 | 3300042616 | Bacteria | 22555 |
| 294 | Ga0466715_332518 | 3300042616 | Bacteria | 5922 |
| 295 | Ga0466723_044432 | 3300042618 | Bacteria | 3594 |
| 296 | Ga0466723_282148 | 3300042618 | Unclassified | 1073 |
| 297 | Ga0466726_069100 | 3300042619 | Bacteria | 5355 |
| 298 | Ga0466726_257952 | 3300042619 | Bacteria | 1763 |
| 299 | Ga0466728_349355 | 3300042620 | Bacteria | 3211 |
| 300 | Ga0466729_106187 | 3300042621 | Bacteria | 19633 |
| 301 | Ga0123355_10975382 | 3300009826 | Bacteria | 905 |
| 302 | Ga0123356_10003573 | 3300010049 | Bacteria | 16250 |
| 303 | Ga0123356_10054982 | 3300010049 | Bacteria | 3707 |
| 304 | Ga0123353_10424953 | 3300010167 | Bacteria | 1967 |
| 305 | Ga0123353_10742333 | 3300010167 | Bacteria | 1368 |
| 306 | Ga0466706_228754 | 3300042599 | Bacteria | 25710 |
| 307 | Ga0466713_072740 | 3300042602 | Bacteria | 29878 |
| 308 | Ga0466717_082346 | 3300042604 | Bacteria | 3074 |
| 309 | Ga0466716_046815 | 3300042605 | Bacteria | 19887 |
| 310 | Ga0466719_093827 | 3300042606 | Bacteria | 3939 |
| 311 | Ga0466721_165241 | 3300042608 | Bacteria | 1550 |
| 312 | Ga0466722_171846 | 3300042609 | Bacteria | 4907 |
| 313 | Ga0466731_175875 | 3300042622 | Bacteria | 1423 |
| 314 | Ga0466735_062399 | 3300042624 | Bacteria | 1851 |
| 315 | Ga0466703_382600 | 3300042636 | Bacteria | 1274 |
| 316 | Ga0466704_492020 | 3300042643 | Bacteria | 3281 |
| 317 | Ga0466724_26953 | 3300042649 | Bacteria | 173225 |
| 318 | Ga0466708_169565 | 3300042652 | Bacteria | 34312 |
| 319 | Ga0466690_037685 | 3300042590 | Bacteria | 26615 |
| 320 | Ga0466691_002327 | 3300042593 | Bacteria | 14502 |
| 321 | Ga0466691_037573 | 3300042593 | Bacteria | 71526 |
| 322 | Ga0466695_300014 | 3300042595 | Bacteria | 2349 |
| 323 | Ga0466696_064664 | 3300042596 | Bacteria | 19517 |
| 324 | Ga0466696_113757 | 3300042596 | Bacteria | 7511 |
| 325 | Ga0466699_408481 | 3300042597 | Bacteria | 1059 |
| 326 | IMNBL1DRAFT_c0010046 | 3300000062 | Bacteria | 4586 |
| 327 | AustNasuHG_c1041283 | 3300000089 | Unclassified | 1114 |
| 328 | JGI24705J35276_12202507 | 3300002504 | Bacteria | 1639 |
| 329 | Ga0123357_10000138 | 3300009784 | Bacteria | 64003 |
| 330 | Ga0466710_453259 | 3300042613 | Bacteria | 4177 |
| 331 | Ga0466711_047765 | 3300042615 | Bacteria | 35661 |
| 332 | Ga0466711_496045 | 3300042615 | Unclassified | 3617 |
| 333 | Ga0466715_364165 | 3300042616 | Bacteria | 16347 |
| 334 | Ga0466715_586714 | 3300042616 | Bacteria | 57830 |
| 335 | Ga0466723_345637 | 3300042618 | Bacteria | 2296 |
| 336 | Ga0466729_037781 | 3300042621 | Bacteria | 19751 |
| 337 | Ga0123357_10180198 | 3300009784 | Bacteria | 2470 |
| 338 | Ga0123355_10542405 | 3300009826 | Bacteria | 1411 |
| 339 | Ga0123356_10018638 | 3300010049 | Bacteria | 6586 |
| 340 | Ga0123356_10310892 | 3300010049 | Unclassified | 1685 |
| 341 | Ga0123356_11024520 | 3300010049 | Bacteria | 995 |
| 342 | Ga0123354_10025356 | 3300010882 | Bacteria | 9348 |
| 343 | Ga0123354_10134818 | 3300010882 | Bacteria | 3094 |
| 344 | Ga0466701_030973 | 3300042598 | Unclassified | 1155 |
| 345 | Ga0466701_049872 | 3300042598 | Bacteria | 8970 |
| 346 | Ga0466706_060424 | 3300042599 | Bacteria | 5778 |
| 347 | Ga0466700_233886 | 3300042600 | Bacteria | 5710 |
| 348 | Ga0466707_374739 | 3300042601 | Bacteria | 28797 |
| 349 | Ga0466707_417016 | 3300042601 | Bacteria | 1127 |
| 350 | Ga0466716_014479 | 3300042605 | Bacteria | 30537 |
| 351 | Ga0466716_532094 | 3300042605 | Bacteria | 21649 |
| 352 | Ga0466719_009880 | 3300042606 | Unclassified | 1904 |
| 353 | Ga0466730_014607 | 3300042625 | Unclassified | 2206 |
| 354 | Ga0466702_060833 | 3300042635 | Unclassified | 1590 |
| 355 | Ga0466703_184001 | 3300042636 | Bacteria | 6232 |
| 356 | Ga0466709_118330 | 3300042648 | Unclassified | 2688 |
| 357 | Ga0466724_68350 | 3300042649 | Bacteria | 1150 |
| 358 | Ga0466708_097473 | 3300042652 | Bacteria | 40764 |
| 359 | Ga0466708_180697 | 3300042652 | Bacteria | 16849 |
| 360 | Ga0466725_380104 | 3300042654 | Bacteria | 28941 |
| 361 | Ga0466727_040337 | 3300042655 | Bacteria | 31698 |
| 362 | Ga0160455_100068 | 3300012837 | Bacteria | 188813 |
| 363 | Ga0466656_326672 | 3300042550 | Bacteria | 1234 |
| 364 | Ga0466657_096906 | 3300042582 | Unclassified | 1327 |
| 365 | Ga0466690_261027 | 3300042590 | Bacteria | 17850 |
| 366 | Ga0466696_005318 | 3300042596 | Bacteria | 52289 |
| 367 | Ga0466696_436433 | 3300042596 | Bacteria | 22667 |
| 368 | Ga0466699_030981 | 3300042597 | Bacteria | 1502 |
| 369 | IMNBGM34_c000940 | 3300000036 | Bacteria | 6311 |
| 370 | JGI24702J35022_10005043 | 3300002462 | Bacteria | 7778 |
| 371 | JGI24705J35276_12237141 | 3300002504 | Bacteria | 9947 |
| 372 | Ga0103265_1000005 | 3300007068 | Bacteria | 101135 |
| 373 | Ga0103267_1000251 | 3300007190 | Bacteria | 20440 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00297 | Ribosomal_L3 | Ribosomal protein L3 | 134 | 219 | 0.82 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.