Protein Family IF01338
Metagenome
Isolate
248
Members
76
Samples
224
Scaffolds
146.33
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1080669|Ga0072941_10806693
- Length
- 135 aa
- Sequence
- MNLHNLKPAEGSTKKTKRIGRGEGSGHGGTSTRGHFEGGQMPMQRRLPKFGFNNINRVEYKAINVSTLQALAEKCSIDTITVDTLVEHGLASKNSRVKILGNGELNVKLNVTAHAFSKSAVAAIEAKQGVATKL*
Sample Types
Isolate
9.7%
Metagenome
90.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.7%
Blattidae
25.7%
Kalotermitidae
18.9%
Unclassified
9.5%
Rhinotermitidae
5.4%
Termopsidae
5.4%
Passalidae
2.7%
Hodotermitidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
0
Bacteria
239
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 3 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 4 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 12 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 18 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 19 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 20 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 21 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 34 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 35 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 36 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 37 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 40 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 41 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 42 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 43 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 44 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 45 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 47 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 48 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 49 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 53 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 54 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 55 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 56 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 57 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 58 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 59 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 60 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 61 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 62 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 63 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 64 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 65 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 66 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 67 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 68 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 74 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 75 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 76 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_122413 | 3300042659 | Bacteria | 26318 |
| 2 | Ga0123356_10087291 | 3300010049 | Bacteria | 2963 |
| 3 | Ga0123356_12115928 | 3300010049 | Bacteria | 703 |
| 4 | Ga0123353_10470657 | 3300010167 | Unclassified | 1843 |
| 5 | Ga0123353_12822873 | 3300010167 | Bacteria | 568 |
| 6 | Ga0123354_10119434 | 3300010882 | Bacteria | 3415 |
| 7 | Ga0466715_044375 | 3300042616 | Bacteria | 14700 |
| 8 | Ga0466723_123534 | 3300042618 | Bacteria | 8663 |
| 9 | Ga0466723_184116 | 3300042618 | Bacteria | 30069 |
| 10 | Ga0466728_235463 | 3300042620 | Bacteria | 2137 |
| 11 | Ga0466701_074471 | 3300042598 | Bacteria | 3074 |
| 12 | Ga0466707_194386 | 3300042601 | Bacteria | 27039 |
| 13 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 14 | Ga0466722_108524 | 3300042609 | Bacteria | 6122 |
| 15 | Ga0466722_143981 | 3300042609 | Bacteria | 20003 |
| 16 | 2227623535 | 2225789004 | Bacteria | 2170 |
| 17 | IMNBL1DRAFT_c0000119 | 3300000062 | Bacteria | 71190 |
| 18 | Ga0068305_10010112 | 3300005083 | Bacteria | 17726 |
| 19 | Ga0466657_266564 | 3300042582 | Bacteria | 1996 |
| 20 | Ga0466690_136616 | 3300042590 | Bacteria | 29160 |
| 21 | Ga0466692_024662 | 3300042591 | Bacteria | 1399 |
| 22 | Ga0466692_142563 | 3300042591 | Bacteria | 9391 |
| 23 | Ga0466735_060130 | 3300042624 | Bacteria | 1341 |
| 24 | Ga0466703_369160 | 3300042636 | Bacteria | 28465 |
| 25 | Ga0466709_083357 | 3300042648 | Bacteria | 39489 |
| 26 | Ga0466709_118201 | 3300042648 | Bacteria | 25211 |
| 27 | Ga0466709_129005 | 3300042648 | Bacteria | 13583 |
| 28 | Ga0466727_225049 | 3300042655 | Bacteria | 48864 |
| 29 | Ga0123357_10097966 | 3300009784 | Bacteria | 3792 |
| 30 | Ga0123357_10137196 | 3300009784 | Bacteria | 3020 |
| 31 | Ga0466711_030146 | 3300042615 | Bacteria | 6235 |
| 32 | Ga0466715_076088 | 3300042616 | Bacteria | 9712 |
| 33 | Ga0466723_362486 | 3300042618 | Bacteria | 1099 |
| 34 | Ga0466726_346162 | 3300042619 | Bacteria | 2462 |
| 35 | Ga0466706_003151 | 3300042599 | Bacteria | 1202 |
| 36 | Ga0466706_177219 | 3300042599 | Bacteria | 25525 |
| 37 | Ga0466706_237799 | 3300042599 | Bacteria | 2044 |
| 38 | Ga0466714_059082 | 3300042603 | Bacteria | 46712 |
| 39 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 40 | Ga0466714_101031 | 3300042603 | Bacteria | 79046 |
| 41 | Ga0466716_237498 | 3300042605 | Bacteria | 3703 |
| 42 | Ga0466716_495889 | 3300042605 | Bacteria | 3680 |
| 43 | Ga0466719_246678 | 3300042606 | Bacteria | 8577 |
| 44 | Ga0466722_025001 | 3300042609 | Bacteria | 4342 |
| 45 | Ga0466722_077240 | 3300042609 | Bacteria | 7055 |
| 46 | IMNBL1DRAFT_c0003207 | 3300000062 | Bacteria | 10697 |
| 47 | JGI24702J35022_10005168 | 3300002462 | Bacteria | 7657 |
| 48 | JGI24705J35276_12223223 | 3300002504 | Bacteria | 2489 |
| 49 | Ga0068302_10032438 | 3300005071 | Bacteria | 4288 |
| 50 | Ga0466690_383037 | 3300042590 | Bacteria | 7258 |
| 51 | Ga0466691_204814 | 3300042593 | Bacteria | 23707 |
| 52 | Ga0466695_042940 | 3300042595 | Bacteria | 2765 |
| 53 | Ga0466696_286290 | 3300042596 | Bacteria | 1325 |
| 54 | Ga0466735_064263 | 3300042624 | Bacteria | 2824 |
| 55 | Ga0466735_141295 | 3300042624 | Bacteria | 3256 |
| 56 | Ga0466730_079377 | 3300042625 | Bacteria | 4647 |
| 57 | Ga0466703_417292 | 3300042636 | Bacteria | 5033 |
| 58 | Ga0466704_552057 | 3300042643 | Bacteria | 6449 |
| 59 | Ga0466704_619871 | 3300042643 | Bacteria | 22946 |
| 60 | Ga0466709_000304 | 3300042648 | Bacteria | 8299 |
| 61 | Ga0466697_101303 | 3300042611 | Bacteria | 1406 |
| 62 | Ga0466705_339741 | 3300042612 | Unclassified | 1635 |
| 63 | Ga0123356_10074292 | 3300010049 | Bacteria | 3198 |
| 64 | Ga0123354_10000176 | 3300010882 | Bacteria | 53249 |
| 65 | Ga0123354_10159030 | 3300010882 | Bacteria | 2693 |
| 66 | Ga0466711_092510 | 3300042615 | Bacteria | 9915 |
| 67 | Ga0466711_212221 | 3300042615 | Bacteria | 10563 |
| 68 | Ga0466711_212781 | 3300042615 | Bacteria | 3826 |
| 69 | Ga0466711_289238 | 3300042615 | Bacteria | 45865 |
| 70 | Ga0466723_373256 | 3300042618 | Bacteria | 33738 |
| 71 | Ga0466726_109952 | 3300042619 | Bacteria | 1112 |
| 72 | Ga0466701_098566 | 3300042598 | Bacteria | 20155 |
| 73 | Ga0466706_259354 | 3300042599 | Bacteria | 1724 |
| 74 | Ga0466700_440838 | 3300042600 | Bacteria | 1078 |
| 75 | Ga0466707_398960 | 3300042601 | Bacteria | 15809 |
| 76 | Ga0466722_210785 | 3300042609 | Bacteria | 4412 |
| 77 | IMNBL1DRAFT_c0003005 | 3300000062 | Bacteria | 11178 |
| 78 | IMNBL1DRAFT_c0003450 | 3300000062 | Bacteria | 10155 |
| 79 | Ga0072941_1080669 | 3300005201 | Bacteria | 5010 |
| 80 | Ga0265387_1001514 | 3300024582 | Bacteria | 3401 |
| 81 | Ga0466691_191064 | 3300042593 | Bacteria | 4342 |
| 82 | Ga0466735_008034 | 3300042624 | Bacteria | 5195 |
| 83 | Ga0466725_280895 | 3300042654 | Bacteria | 1088 |
| 84 | Ga0466727_063087 | 3300042655 | Bacteria | 8570 |
| 85 | Ga0466727_260920 | 3300042655 | Bacteria | 6356 |
| 86 | Ga0466697_139202 | 3300042611 | Bacteria | 1770 |
| 87 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 88 | Ga0466710_086506 | 3300042613 | Bacteria | 1237 |
| 89 | Ga0466715_154449 | 3300042616 | Bacteria | 23802 |
| 90 | Ga0466728_117468 | 3300042620 | Bacteria | 23405 |
| 91 | Ga0466706_064416 | 3300042599 | Bacteria | 22081 |
| 92 | Ga0466706_098228 | 3300042599 | Bacteria | 39742 |
| 93 | Ga0466706_126288 | 3300042599 | Bacteria | 17453 |
| 94 | Ga0466706_261195 | 3300042599 | Bacteria | 2955 |
| 95 | Ga0466713_129806 | 3300042602 | Bacteria | 35433 |
| 96 | Ga0466697_018053 | 3300042611 | Bacteria | 1879 |
| 97 | 2227184690 | 2225789004 | Bacteria | 1484 |
| 98 | JGI24705J35276_11899521 | 3300002504 | Bacteria | 750 |
| 99 | Ga0466690_130793 | 3300042590 | Bacteria | 15221 |
| 100 | Ga0466693_298718 | 3300042592 | Bacteria | 1556 |
| 101 | Ga0466696_077742 | 3300042596 | Bacteria | 7588 |
| 102 | Ga0466731_131517 | 3300042622 | Bacteria | 1948 |
| 103 | Ga0466735_011934 | 3300042624 | Bacteria | 2884 |
| 104 | Ga0466735_025800 | 3300042624 | Bacteria | 1791 |
| 105 | Ga0466703_105741 | 3300042636 | Bacteria | 30105 |
| 106 | Ga0466703_374219 | 3300042636 | Bacteria | 24808 |
| 107 | Ga0466704_115291 | 3300042643 | Bacteria | 19465 |
| 108 | Ga0466704_249780 | 3300042643 | Bacteria | 8800 |
| 109 | Ga0466708_014146 | 3300042652 | Bacteria | 33245 |
| 110 | Ga0466697_161541 | 3300042611 | Bacteria | 2598 |
| 111 | Ga0466705_346556 | 3300042612 | Unclassified | 1764 |
| 112 | Ga0123353_10529325 | 3300010167 | Bacteria | 1707 |
| 113 | Ga0466711_095236 | 3300042615 | Bacteria | 15743 |
| 114 | Ga0466711_141717 | 3300042615 | Bacteria | 15726 |
| 115 | Ga0466715_025469 | 3300042616 | Bacteria | 20577 |
| 116 | Ga0466728_139914 | 3300042620 | Bacteria | 13626 |
| 117 | Ga0466701_084874 | 3300042598 | Bacteria | 1026 |
| 118 | Ga0466706_118256 | 3300042599 | Bacteria | 1244 |
| 119 | Ga0466706_237229 | 3300042599 | Bacteria | 5073 |
| 120 | Ga0466706_252632 | 3300042599 | Bacteria | 4964 |
| 121 | Ga0466707_048580 | 3300042601 | Bacteria | 11796 |
| 122 | Ga0466707_248411 | 3300042601 | Bacteria | 1679 |
| 123 | Ga0466707_360699 | 3300042601 | Bacteria | 17316 |
| 124 | Ga0466713_027800 | 3300042602 | Bacteria | 40167 |
| 125 | 2227194703 | 2225789004 | Bacteria | 7845 |
| 126 | 2227517976 | 2225789004 | Bacteria | 3399 |
| 127 | IMNBL1DRAFT_c0000677 | 3300000062 | Bacteria | 27305 |
| 128 | JGI24702J35022_10002597 | 3300002462 | Bacteria | 10970 |
| 129 | JGI24699J35502_11114554 | 3300002509 | Bacteria | 2866 |
| 130 | Ga0068305_10296985 | 3300005083 | Bacteria | 2453 |
| 131 | Ga0466657_098945 | 3300042582 | Bacteria | 51985 |
| 132 | Ga0466690_075785 | 3300042590 | Bacteria | 45904 |
| 133 | Ga0466693_019228 | 3300042592 | Bacteria | 2315 |
| 134 | Ga0466695_284405 | 3300042595 | Bacteria | 1191 |
| 135 | Ga0466696_057822 | 3300042596 | Bacteria | 24547 |
| 136 | Ga0466735_012338 | 3300042624 | Bacteria | 1490 |
| 137 | Ga0466735_060463 | 3300042624 | Bacteria | 1011 |
| 138 | Ga0466735_080555 | 3300042624 | Bacteria | 12371 |
| 139 | Ga0466735_129234 | 3300042624 | Bacteria | 4257 |
| 140 | Ga0466725_037990 | 3300042654 | Bacteria | 18222 |
| 141 | Ga0466727_082800 | 3300042655 | Bacteria | 3545 |
| 142 | Ga0466705_023652 | 3300042612 | Bacteria | 16774 |
| 143 | Ga0123357_10229301 | 3300009784 | Bacteria | 2040 |
| 144 | Ga0123356_10785714 | 3300010049 | Bacteria | 1123 |
| 145 | Ga0466705_502503 | 3300042612 | Bacteria | 16070 |
| 146 | Ga0466711_185967 | 3300042615 | Bacteria | 6230 |
| 147 | Ga0466711_228133 | 3300042615 | Bacteria | 7712 |
| 148 | Ga0466715_013468 | 3300042616 | Bacteria | 26887 |
| 149 | Ga0466715_119604 | 3300042616 | Bacteria | 22555 |
| 150 | Ga0466715_381837 | 3300042616 | Bacteria | 3395 |
| 151 | Ga0466729_106187 | 3300042621 | Bacteria | 19633 |
| 152 | Ga0466729_112686 | 3300042621 | Bacteria | 10506 |
| 153 | Ga0466713_072740 | 3300042602 | Bacteria | 29878 |
| 154 | Ga0466716_335360 | 3300042605 | Bacteria | 11224 |
| 155 | JGI24705J35276_11943024 | 3300002504 | Unclassified | 787 |
| 156 | JGI24705J35276_12077883 | 3300002504 | Bacteria | 967 |
| 157 | JGI24699J35502_11134150 | 3300002509 | Bacteria | 37878 |
| 158 | Ga0265387_1041842 | 3300024582 | Bacteria | 789 |
| 159 | Ga0466656_344865 | 3300042550 | Bacteria | 2382 |
| 160 | Ga0466657_015820 | 3300042582 | Bacteria | 1199 |
| 161 | Ga0466729_256895 | 3300042621 | Bacteria | 1920 |
| 162 | Ga0466735_017313 | 3300042624 | Bacteria | 6644 |
| 163 | Ga0466703_073446 | 3300042636 | Bacteria | 8423 |
| 164 | Ga0466704_415186 | 3300042643 | Bacteria | 17633 |
| 165 | Ga0466727_298973 | 3300042655 | Bacteria | 9257 |
| 166 | Ga0466705_058096 | 3300042612 | Bacteria | 11192 |
| 167 | Ga0123357_10019205 | 3300009784 | Bacteria | 9102 |
| 168 | Ga0123357_10057959 | 3300009784 | Bacteria | 5203 |
| 169 | Ga0123357_10064406 | 3300009784 | Bacteria | 4898 |
| 170 | Ga0123357_10159037 | 3300009784 | Bacteria | 2715 |
| 171 | Ga0123357_10377655 | 3300009784 | Bacteria | 1320 |
| 172 | Ga0123355_10001369 | 3300009826 | Bacteria | 33944 |
| 173 | Ga0123356_10536129 | 3300010049 | Bacteria | 1330 |
| 174 | Ga0123356_11768701 | 3300010049 | Bacteria | 768 |
| 175 | Ga0123354_10111676 | 3300010882 | Bacteria | 3604 |
| 176 | Ga0123354_10397951 | 3300010882 | Unclassified | 1169 |
| 177 | Ga0466715_137824 | 3300042616 | Bacteria | 1409 |
| 178 | Ga0466701_076335 | 3300042598 | Bacteria | 60822 |
| 179 | Ga0466698_374367 | 3300042610 | Bacteria | 1742 |
| 180 | IMNBL1DRAFT_c0000355 | 3300000062 | Bacteria | 38787 |
| 181 | IMNBL1DRAFT_c0000682 | 3300000062 | Bacteria | 27226 |
| 182 | IMNBL1DRAFT_c0051540 | 3300000062 | Bacteria | 1295 |
| 183 | Ga0068305_10003312 | 3300005083 | Bacteria | 66359 |
| 184 | Ga0068305_10026156 | 3300005083 | Bacteria | 20761 |
| 185 | Ga0466693_412658 | 3300042592 | Unclassified | 1387 |
| 186 | Ga0466691_103922 | 3300042593 | Bacteria | 19126 |
| 187 | Ga0466696_033396 | 3300042596 | Unclassified | 1840 |
| 188 | Ga0466735_035640 | 3300042624 | Bacteria | 1743 |
| 189 | Ga0466735_043327 | 3300042624 | Bacteria | 1572 |
| 190 | Ga0466735_087275 | 3300042624 | Bacteria | 8538 |
| 191 | Ga0466735_133122 | 3300042624 | Bacteria | 2677 |
| 192 | Ga0466709_208437 | 3300042648 | Bacteria | 82349 |
| 193 | Ga0466733_098924 | 3300042659 | Bacteria | 10647 |
| 194 | Ga0123353_10140364 | 3300010167 | Bacteria | 3871 |
| 195 | Ga0123354_10002374 | 3300010882 | Bacteria | 24762 |
| 196 | Ga0466710_341133 | 3300042613 | Bacteria | 2344 |
| 197 | Ga0466710_437818 | 3300042613 | Bacteria | 1073 |
| 198 | Ga0466711_050658 | 3300042615 | Bacteria | 24311 |
| 199 | Ga0466715_265725 | 3300042616 | Bacteria | 12007 |
| 200 | Ga0466728_019967 | 3300042620 | Bacteria | 2767 |
| 201 | Ga0466701_086347 | 3300042598 | Unclassified | 3426 |
| 202 | Ga0466706_096820 | 3300042599 | Bacteria | 3200 |
| 203 | Ga0466706_176055 | 3300042599 | Bacteria | 1069 |
| 204 | Ga0466707_123522 | 3300042601 | Bacteria | 8117 |
| 205 | Ga0466707_269466 | 3300042601 | Bacteria | 1305 |
| 206 | Ga0466707_374739 | 3300042601 | Bacteria | 28797 |
| 207 | Ga0466713_030797 | 3300042602 | Bacteria | 38314 |
| 208 | Ga0466713_112803 | 3300042602 | Bacteria | 145809 |
| 209 | Ga0466716_532094 | 3300042605 | Bacteria | 21649 |
| 210 | 2227363336 | 2225789004 | Bacteria | 1124 |
| 211 | Ga0123357_10000330 | 3300009784 | Bacteria | 44905 |
| 212 | Ga0466690_032772 | 3300042590 | Bacteria | 29534 |
| 213 | Ga0466690_175771 | 3300042590 | Bacteria | 56622 |
| 214 | Ga0466690_261027 | 3300042590 | Bacteria | 17850 |
| 215 | Ga0466691_039529 | 3300042593 | Bacteria | 29822 |
| 216 | Ga0466696_436433 | 3300042596 | Bacteria | 22667 |
| 217 | Ga0466703_020705 | 3300042636 | Bacteria | 5568 |
| 218 | Ga0466703_021523 | 3300042636 | Bacteria | 4183 |
| 219 | Ga0466703_180446 | 3300042636 | Bacteria | 15145 |
| 220 | Ga0466703_265124 | 3300042636 | Unclassified | 2329 |
| 221 | Ga0466704_055849 | 3300042643 | Bacteria | 53217 |
| 222 | Ga0466704_477103 | 3300042643 | Bacteria | 9640 |
| 223 | Ga0466708_340350 | 3300042652 | Bacteria | 78722 |
| 224 | Ga0466725_046272 | 3300042654 | Bacteria | 2002 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00828 | Ribosomal_L27A | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A | 22 | 131 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.