Protein Family IF01255
Metagenome
Metatranscriptome
Isolate
294
Members
123
Samples
243
Scaffolds
142.39
Avg Length
Representative Sequence
- ID
- 3300005200|Ga0072940_1212484|Ga0072940_12124842
- Length
- 167 aa
- Sequence
- MAKKEIAKIKLQIPAGAANPSPPVGPALGQHGLNIMAFCKEFNARTQDQKGMIIPVVITAYADRSFSFITKTPPAAVLIQKAAKVEKGSGEPNRNKVGSITAAQVEEIARLKMPDLNAASLDAAKRSIMGTARSMGIESGSRIPTGASVGCPCPQKGRRCRKFSTR*
Sample Types
Isolate
17.4%
Metagenome
82.3%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.3%
Unclassified
19.8%
Chrysomelidae
12.4%
Kalotermitidae
11.6%
Formicidae
6.6%
Elmidae
5.0%
Rhinotermitidae
4.1%
Culicidae
4.1%
Termopsidae
2.5%
Passalidae
1.7%
Hodotermitidae
0.8%
Cambaridae
0.8%
Armadillidiidae
0.8%
Kiwaidae
0.8%
Drosophilidae
0.8%
Nephropidae
0.8%
Taxonomy
Archaea
0
Bacteria
256
Eukaryota
0
Viruses
0
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 2 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 3 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 4 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 5 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 13 | 2998830690 | Enterobacteriaceae endosymbiont of Donacia dentata DdentSym | Isolate | Chrysomelidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 18 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 19 | 2821312900 | Unclassified Proteobacteria Lab288P4bin16 | Isolate | Unclassified |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 22 | 2998827899 | Enterobacteriaceae endosymbiont of Donacia cincticornis DcincSym | Isolate | Chrysomelidae |
| 23 | 2998834864 | Enterobacteriaceae endosymbiont of Donacia bicoloricornis DbicSym | Isolate | Chrysomelidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 32 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 35 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 36 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 37 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 38 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 41 | 2999135777 | Enterobacteriaceae endosymbiont of Donacia tomentosa DtomSym | Isolate | Chrysomelidae |
| 42 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 47 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 48 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 49 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 52 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 53 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 54 | 2687453757 | Opitutus sp. Cag34 | Isolate | Unclassified |
| 55 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 56 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 57 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 2998832509 | Enterobacteriaceae endosymbiont of Donacia cinerea DcinSym | Isolate | Chrysomelidae |
| 60 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 61 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 62 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 63 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 64 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 65 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 66 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 67 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 68 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 69 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 70 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 71 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 72 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 73 | 642555127 | Elusimicrobium minutum Pei191 | Isolate | Unclassified |
| 74 | 2998831604 | Enterobacteriaceae endosymbiont of Donacia thalassina DthaSym | Isolate | Chrysomelidae |
| 75 | 2998979428 | Enterobacteriaceae endosymbiont of Donacia fulgens DfulgSym | Isolate | Chrysomelidae |
| 76 | 2999134809 | Enterobacteriaceae endosymbiont of Donacia crassipes DcraSym | Isolate | Chrysomelidae |
| 77 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 78 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 79 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 80 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 81 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 82 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 83 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 84 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 85 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 86 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 87 | 2820070515 | Unclassified Proteobacteria Nt197P3bin137 | Isolate | Unclassified |
| 88 | 2998829729 | Enterobacteriaceae endosymbiont of Donacia sparganii DsparSym | Isolate | Chrysomelidae |
| 89 | 2999134321 | Enterobacteriaceae endosymbiont of Donacia piscatrix DpisSym | Isolate | Chrysomelidae |
| 90 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 91 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 92 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 93 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 94 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 95 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 96 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 97 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 98 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 99 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 100 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 101 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 102 | 2820058318 | Unclassified Proteobacteria Nt197P4bin33 | Isolate | Unclassified |
| 103 | 2603880164 | Opitutus sp. | Isolate | Formicidae |
| 104 | 2998828354 | Enterobacteriaceae endosymbiont of Donacia vulgaris DvulSym | Isolate | Chrysomelidae |
| 105 | 2998833917 | Enterobacteriaceae endosymbiont of Donacia clavipes DclaSym | Isolate | Chrysomelidae |
| 106 | 2999138033 | Enterobacteriaceae endosymbiont of Donacia provostii DprovSym | Isolate | Chrysomelidae |
| 107 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 108 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 109 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 110 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 111 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 112 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 113 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 114 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 115 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 116 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 117 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 118 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 119 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 120 | 2998828810 | Enterobacteriaceae endosymbiont of Donacia simplex DsimSym | Isolate | Chrysomelidae |
| 121 | 2998833461 | Enterobacteriaceae endosymbiont of Donacia marginata DmarSym | Isolate | Chrysomelidae |
| 122 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 123 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_011300 | 3300042612 | Bacteria | 1332 |
| 2 | Ga0466705_139123 | 3300042612 | Bacteria | 19829 |
| 3 | Ga0466701_032908 | 3300042598 | Bacteria | 125245 |
| 4 | Ga0466700_329616 | 3300042600 | Bacteria | 2823 |
| 5 | Ga0466713_036529 | 3300042602 | Bacteria | 7990 |
| 6 | Ga0466719_570990 | 3300042606 | Unclassified | 2374 |
| 7 | Ga0466722_179877 | 3300042609 | Bacteria | 16667 |
| 8 | Ga0123353_10002061 | 3300010167 | Bacteria | 24829 |
| 9 | Ga0123354_10000236 | 3300010882 | Bacteria | 49579 |
| 10 | Ga0466690_050721 | 3300042590 | Bacteria | 2587 |
| 11 | Ga0466690_213473 | 3300042590 | Bacteria | 1555 |
| 12 | Ga0466694_332545 | 3300042594 | Bacteria | 1984 |
| 13 | Ga0466695_316151 | 3300042595 | Bacteria | 1252 |
| 14 | Ga0466696_352929 | 3300042596 | Bacteria | 18884 |
| 15 | Ga0466696_371425 | 3300042596 | Bacteria | 3947 |
| 16 | Ga0466735_005959 | 3300042624 | Bacteria | 1541 |
| 17 | Ga0466735_092999 | 3300042624 | Bacteria | 9364 |
| 18 | Ga0466730_097984 | 3300042625 | Bacteria | 727286 |
| 19 | Ga0466703_138211 | 3300042636 | Bacteria | 1772 |
| 20 | Ga0466704_199331 | 3300042643 | Bacteria | 18275 |
| 21 | Ga0466724_43696 | 3300042649 | Bacteria | 561295 |
| 22 | Ga0466710_061658 | 3300042613 | Bacteria | 1562 |
| 23 | Ga0466710_196985 | 3300042613 | Bacteria | 2471 |
| 24 | Ga0466715_128601 | 3300042616 | Bacteria | 16958 |
| 25 | Ga0466715_304448 | 3300042616 | Bacteria | 4777 |
| 26 | Ga0466715_531788 | 3300042616 | Bacteria | 1766 |
| 27 | Ga0466718_153822 | 3300042617 | Bacteria | 1060 |
| 28 | Ga0466723_198206 | 3300042618 | Bacteria | 1625 |
| 29 | Ga0466726_118993 | 3300042619 | Bacteria | 12177 |
| 30 | IMNBL1DRAFT_c0023955 | 3300000062 | Bacteria | 2377 |
| 31 | JGI24705J35276_12236755 | 3300002504 | Bacteria | 8846 |
| 32 | JGI24696J40584_12958959 | 3300002834 | Bacteria | 4585 |
| 33 | Ga0072940_1021310 | 3300005200 | Unclassified | 3274 |
| 34 | Ga0102734_1000198 | 3300007129 | Unclassified | 28082 |
| 35 | Ga0105524_100067 | 3300007733 | Bacteria | 33090 |
| 36 | Ga0466705_182546 | 3300042612 | Unclassified | 1746 |
| 37 | Ga0466733_083610 | 3300042659 | Bacteria | 33057 |
| 38 | Ga0466701_023409 | 3300042598 | Unclassified | 1023 |
| 39 | Ga0466701_080099 | 3300042598 | Unclassified | 3060 |
| 40 | Ga0466716_136197 | 3300042605 | Bacteria | 4197 |
| 41 | Ga0123357_10020323 | 3300009784 | Bacteria | 8873 |
| 42 | Ga0123355_10003509 | 3300009826 | Bacteria | 22512 |
| 43 | Ga0123355_10191426 | 3300009826 | Bacteria | 3012 |
| 44 | Ga0123353_10557411 | 3300010167 | Unclassified | 1651 |
| 45 | Ga0123353_10698620 | 3300010167 | Unclassified | 1424 |
| 46 | Ga0123354_10125884 | 3300010882 | Unclassified | 3273 |
| 47 | Ga0123354_10313148 | 3300010882 | Bacteria | 1462 |
| 48 | Ga0466690_156281 | 3300042590 | Bacteria | 3170 |
| 49 | Ga0466690_200933 | 3300042590 | Bacteria | 20078 |
| 50 | Ga0466691_199487 | 3300042593 | Bacteria | 168397 |
| 51 | Ga0466695_108534 | 3300042595 | Bacteria | 3654 |
| 52 | Ga0466729_211224 | 3300042621 | Bacteria | 39520 |
| 53 | Ga0466729_212399 | 3300042621 | Bacteria | 1036 |
| 54 | Ga0466703_043228 | 3300042636 | Bacteria | 3544 |
| 55 | Ga0466727_326504 | 3300042655 | Unclassified | 1243 |
| 56 | Ga0466705_497518 | 3300042612 | Bacteria | 2900 |
| 57 | Ga0466710_326205 | 3300042613 | Bacteria | 1001 |
| 58 | Ga0466711_018780 | 3300042615 | Bacteria | 3899 |
| 59 | Ga0466723_126068 | 3300042618 | Bacteria | 9400 |
| 60 | Ga0466728_036119 | 3300042620 | Bacteria | 39738 |
| 61 | Ga0466728_427667 | 3300042620 | Bacteria | 41368 |
| 62 | CVPL005L_10001298 | 3300002938 | Bacteria | 28592 |
| 63 | Ga0103264_1000219 | 3300007188 | Bacteria | 65897 |
| 64 | Ga0466705_011731 | 3300042612 | Bacteria | 22616 |
| 65 | Ga0466705_214528 | 3300042612 | Unclassified | 15565 |
| 66 | Ga0466707_302050 | 3300042601 | Bacteria | 1783 |
| 67 | Ga0466714_090286 | 3300042603 | Bacteria | 3528 |
| 68 | Ga0466719_087713 | 3300042606 | Bacteria | 8017 |
| 69 | Ga0466722_001528 | 3300042609 | Bacteria | 5092 |
| 70 | Ga0123357_10004296 | 3300009784 | Bacteria | 16678 |
| 71 | Ga0123357_10211338 | 3300009784 | Bacteria | 2178 |
| 72 | Ga0123357_10409393 | 3300009784 | Bacteria | 1224 |
| 73 | Ga0123357_10756292 | 3300009784 | Unclassified | 674 |
| 74 | Ga0123356_11932920 | 3300010049 | Bacteria | 735 |
| 75 | Ga0123356_12082041 | 3300010049 | Unclassified | 708 |
| 76 | Ga0123354_10471836 | 3300010882 | Bacteria | 999 |
| 77 | Ga0157631_103664 | 3300013007 | Bacteria | 1092 |
| 78 | Ga0264413_152389 | 3300024493 | Bacteria | 3508 |
| 79 | Ga0466690_071267 | 3300042590 | Bacteria | 2790 |
| 80 | Ga0466692_195905 | 3300042591 | Bacteria | 6901 |
| 81 | Ga0466696_474197 | 3300042596 | Bacteria | 4699 |
| 82 | Ga0466735_044871 | 3300042624 | Bacteria | 18053 |
| 83 | Ga0466703_397497 | 3300042636 | Bacteria | 14278 |
| 84 | Ga0466704_214471 | 3300042643 | Bacteria | 2143 |
| 85 | Ga0466709_179201 | 3300042648 | Bacteria | 14531 |
| 86 | Ga0466709_392543 | 3300042648 | Unclassified | 1378 |
| 87 | Ga0466727_080349 | 3300042655 | Bacteria | 11201 |
| 88 | Ga0466711_116124 | 3300042615 | Bacteria | 9975 |
| 89 | Ga0466723_031503 | 3300042618 | Unclassified | 60501 |
| 90 | Ga0466726_457054 | 3300042619 | Bacteria | 2334 |
| 91 | 2227229981 | 2225789004 | Bacteria | 1367 |
| 92 | Ga0104045_1091241 | 3300007085 | Bacteria | 651 |
| 93 | Ga0103260_1000030 | 3300007139 | Bacteria | 66904 |
| 94 | Ga0466697_067307 | 3300042611 | Bacteria | 1999 |
| 95 | Ga0466706_161343 | 3300042599 | Bacteria | 5294 |
| 96 | Ga0466717_190688 | 3300042604 | Bacteria | 3256 |
| 97 | Ga0466716_140834 | 3300042605 | Bacteria | 166440 |
| 98 | Ga0466716_526127 | 3300042605 | Bacteria | 2206 |
| 99 | Ga0466722_073428 | 3300042609 | Bacteria | 10475 |
| 100 | Ga0123357_10232718 | 3300009784 | Unclassified | 2015 |
| 101 | Ga0123357_10472450 | 3300009784 | Unclassified | 1067 |
| 102 | Ga0123357_10668326 | 3300009784 | Bacteria | 760 |
| 103 | Ga0123353_12222264 | 3300010167 | Bacteria | 663 |
| 104 | Ga0157631_111318 | 3300013007 | Bacteria | 6137 |
| 105 | Ga0222431_1061222 | 3300021190 | Bacteria | 961 |
| 106 | Ga0466695_016849 | 3300042595 | Bacteria | 1658 |
| 107 | Ga0466695_297549 | 3300042595 | Bacteria | 1157 |
| 108 | Ga0466734_098773 | 3300042623 | Bacteria | 1167 |
| 109 | Ga0466735_149023 | 3300042624 | Bacteria | 2370 |
| 110 | Ga0466703_057270 | 3300042636 | Bacteria | 105430 |
| 111 | Ga0466703_296114 | 3300042636 | Bacteria | 1506 |
| 112 | Ga0466703_363173 | 3300042636 | Bacteria | 7440 |
| 113 | Ga0466704_064279 | 3300042643 | Bacteria | 19660 |
| 114 | Ga0466709_061915 | 3300042648 | Bacteria | 20339 |
| 115 | Ga0466708_199867 | 3300042652 | Bacteria | 18655 |
| 116 | Ga0466708_408047 | 3300042652 | Bacteria | 30845 |
| 117 | Ga0466710_269743 | 3300042613 | Bacteria | 1141 |
| 118 | Ga0466715_558180 | 3300042616 | Bacteria | 2146 |
| 119 | Ga0466718_124203 | 3300042617 | Bacteria | 1305 |
| 120 | Ga0466723_347862 | 3300042618 | Bacteria | 2861 |
| 121 | IMNBL1DRAFT_c0045952 | 3300000062 | Bacteria | 1421 |
| 122 | Ga0103265_1000007 | 3300007068 | Bacteria | 131664 |
| 123 | Ga0466705_290326 | 3300042612 | Unclassified | 6154 |
| 124 | Ga0466700_123442 | 3300042600 | Unclassified | 1287 |
| 125 | Ga0466700_454675 | 3300042600 | Bacteria | 7428 |
| 126 | Ga0466707_028776 | 3300042601 | Bacteria | 91932 |
| 127 | Ga0466707_045470 | 3300042601 | Bacteria | 2418 |
| 128 | Ga0466707_371642 | 3300042601 | Unclassified | 12495 |
| 129 | Ga0466713_043758 | 3300042602 | Bacteria | 37159 |
| 130 | Ga0466716_200811 | 3300042605 | Bacteria | 15529 |
| 131 | Ga0466722_120902 | 3300042609 | Bacteria | 15763 |
| 132 | Ga0466698_237902 | 3300042610 | Unclassified | 1229 |
| 133 | Ga0466698_358248 | 3300042610 | Bacteria | 3452 |
| 134 | Ga0466697_028114 | 3300042611 | Unclassified | 1186 |
| 135 | Ga0123356_10274777 | 3300010049 | Bacteria | 1776 |
| 136 | Ga0123356_10814107 | 3300010049 | Bacteria | 1105 |
| 137 | Ga0123356_12927776 | 3300010049 | Bacteria | 597 |
| 138 | Ga0123353_10599468 | 3300010167 | Unclassified | 1575 |
| 139 | Ga0123354_10117087 | 3300010882 | Unclassified | 3470 |
| 140 | Ga0466656_073158 | 3300042550 | Bacteria | 1231 |
| 141 | Ga0466690_036210 | 3300042590 | Bacteria | 36848 |
| 142 | Ga0466690_148278 | 3300042590 | Bacteria | 64748 |
| 143 | Ga0466693_259993 | 3300042592 | Unclassified | 1560 |
| 144 | Ga0466703_028570 | 3300042636 | Bacteria | 3199 |
| 145 | Ga0466703_057556 | 3300042636 | Unclassified | 2515 |
| 146 | Ga0466704_113807 | 3300042643 | Bacteria | 12054 |
| 147 | Ga0466725_026934 | 3300042654 | Unclassified | 13267 |
| 148 | Ga0466715_260289 | 3300042616 | Bacteria | 44044 |
| 149 | Ga0466726_165007 | 3300042619 | Bacteria | 18844 |
| 150 | 2227495439 | 2225789004 | Bacteria | 767 |
| 151 | Ga0102736_1000303 | 3300007052 | Bacteria | 10695 |
| 152 | Ga0466732_381602 | 3300042656 | Unclassified | 1308 |
| 153 | Ga0466733_148616 | 3300042659 | Bacteria | 29140 |
| 154 | Ga0466700_036707 | 3300042600 | Bacteria | 11501 |
| 155 | Ga0466707_331953 | 3300042601 | Bacteria | 2996 |
| 156 | Ga0466707_401566 | 3300042601 | Unclassified | 2170 |
| 157 | Ga0466714_071747 | 3300042603 | Bacteria | 1505 |
| 158 | Ga0466717_080816 | 3300042604 | Bacteria | 1138 |
| 159 | Ga0466719_040056 | 3300042606 | Bacteria | 2562 |
| 160 | Ga0123353_10002469 | 3300010167 | Bacteria | 22996 |
| 161 | Ga0123353_10004430 | 3300010167 | Unclassified | 18084 |
| 162 | Ga0123353_10602971 | 3300010167 | Bacteria | 1569 |
| 163 | Ga0123354_10002035 | 3300010882 | Bacteria | 26026 |
| 164 | Ga0415639_061911 | 3300038395 | Bacteria | 3707 |
| 165 | Ga0466690_206197 | 3300042590 | Bacteria | 31478 |
| 166 | Ga0466690_345314 | 3300042590 | Bacteria | 3079 |
| 167 | Ga0466696_331938 | 3300042596 | Bacteria | 1435 |
| 168 | Ga0466699_127381 | 3300042597 | Bacteria | 84968 |
| 169 | Ga0466731_362242 | 3300042622 | Bacteria | 1002 |
| 170 | Ga0466704_128307 | 3300042643 | Bacteria | 102387 |
| 171 | Ga0466704_263142 | 3300042643 | Bacteria | 6679 |
| 172 | Ga0466708_021042 | 3300042652 | Bacteria | 36953 |
| 173 | Ga0466715_452020 | 3300042616 | Bacteria | 2168 |
| 174 | Ga0466715_550133 | 3300042616 | Bacteria | 1568 |
| 175 | Ga0466715_583730 | 3300042616 | Bacteria | 3376 |
| 176 | Ga0466718_021282 | 3300042617 | Bacteria | 3259 |
| 177 | Ga0466718_023003 | 3300042617 | Unclassified | 1130 |
| 178 | Ga0466723_350590 | 3300042618 | Bacteria | 11181 |
| 179 | Ga0466728_117382 | 3300042620 | Bacteria | 1686 |
| 180 | 2227512972 | 2225789004 | Bacteria | 3512 |
| 181 | JGI24702J35022_10003014 | 3300002462 | Bacteria | 10190 |
| 182 | JGI24702J35022_10026761 | 3300002462 | Unclassified | 3105 |
| 183 | Ga0068305_10126373 | 3300005083 | Bacteria | 11290 |
| 184 | Ga0072940_1212484 | 3300005200 | Bacteria | 2320 |
| 185 | Ga0105524_101590 | 3300007733 | Bacteria | 10289 |
| 186 | Ga0466701_102850 | 3300042598 | Unclassified | 22412 |
| 187 | Ga0466713_103812 | 3300042602 | Bacteria | 226548 |
| 188 | Ga0466716_224618 | 3300042605 | Unclassified | 2705 |
| 189 | Ga0466719_229272 | 3300042606 | Bacteria | 10596 |
| 190 | Ga0466721_344962 | 3300042608 | Bacteria | 3918 |
| 191 | Ga0123355_10698418 | 3300009826 | Bacteria | 1166 |
| 192 | Ga0123355_11122215 | 3300009826 | Bacteria | 815 |
| 193 | Ga0123356_10678978 | 3300010049 | Bacteria | 1198 |
| 194 | Ga0123356_10702441 | 3300010049 | Bacteria | 1180 |
| 195 | Ga0123356_12098639 | 3300010049 | Unclassified | 706 |
| 196 | Ga0160456_105137 | 3300012820 | Bacteria | 1625 |
| 197 | Ga0466692_106578 | 3300042591 | Bacteria | 27303 |
| 198 | Ga0466696_013993 | 3300042596 | Bacteria | 65634 |
| 199 | Ga0466735_228732 | 3300042624 | Bacteria | 1345 |
| 200 | Ga0466730_001672 | 3300042625 | Bacteria | 1071 |
| 201 | Ga0466704_067517 | 3300042643 | Bacteria | 3299 |
| 202 | Ga0466723_194584 | 3300042618 | Bacteria | 3191 |
| 203 | 2227105801 | 2225789004 | Bacteria | 9510 |
| 204 | IMNBL1DRAFT_c0058720 | 3300000062 | Bacteria | 1167 |
| 205 | Meta3P_1004289 | 3300002464 | Bacteria | 6284 |
| 206 | JGI24705J35276_12236316 | 3300002504 | Bacteria | 7818 |
| 207 | Ga0068305_10159753 | 3300005083 | Bacteria | 3038 |
| 208 | Ga0102734_1000031 | 3300007129 | Bacteria | 55117 |
| 209 | Ga0102738_1000043 | 3300007141 | Bacteria | 148098 |
| 210 | Ga0466705_154439 | 3300042612 | Bacteria | 3874 |
| 211 | Ga0466705_240431 | 3300042612 | Bacteria | 7582 |
| 212 | Ga0466706_287797 | 3300042599 | Bacteria | 1213 |
| 213 | Ga0466717_106552 | 3300042604 | Bacteria | 1332 |
| 214 | Ga0466719_133866 | 3300042606 | Unclassified | 1657 |
| 215 | Ga0466719_204462 | 3300042606 | Bacteria | 69822 |
| 216 | Ga0466722_052479 | 3300042609 | Bacteria | 16286 |
| 217 | Ga0123357_10126095 | 3300009784 | Bacteria | 3206 |
| 218 | Ga0123356_10002383 | 3300010049 | Bacteria | 20129 |
| 219 | Ga0123356_10387415 | 3300010049 | Bacteria | 1532 |
| 220 | Ga0123353_10030156 | 3300010167 | Bacteria | 8375 |
| 221 | Ga0123353_10062581 | 3300010167 | Unclassified | 5967 |
| 222 | Ga0123353_10363312 | 3300010167 | Bacteria | 2174 |
| 223 | Ga0157631_138638 | 3300013007 | Bacteria | 501 |
| 224 | Ga0466656_007610 | 3300042550 | Bacteria | 4046 |
| 225 | Ga0466657_023074 | 3300042582 | Bacteria | 1001 |
| 226 | Ga0466690_232267 | 3300042590 | Bacteria | 10159 |
| 227 | Ga0466691_174491 | 3300042593 | Bacteria | 3852 |
| 228 | Ga0466694_047018 | 3300042594 | Bacteria | 34555 |
| 229 | Ga0466694_250151 | 3300042594 | Bacteria | 1032 |
| 230 | Ga0466696_023283 | 3300042596 | Bacteria | 149582 |
| 231 | Ga0466703_054894 | 3300042636 | Bacteria | 44772 |
| 232 | Ga0466703_384516 | 3300042636 | Bacteria | 9350 |
| 233 | Ga0466704_596899 | 3300042643 | Bacteria | 11870 |
| 234 | Ga0466727_039273 | 3300042655 | Bacteria | 6160 |
| 235 | Ga0466705_503902 | 3300042612 | Bacteria | 1817 |
| 236 | Ga0466711_348284 | 3300042615 | Unclassified | 1109 |
| 237 | Ga0466715_123583 | 3300042616 | Bacteria | 60701 |
| 238 | Ga0466715_124771 | 3300042616 | Bacteria | 37712 |
| 239 | Ga0466718_065758 | 3300042617 | Bacteria | 194574 |
| 240 | Ga0466723_068673 | 3300042618 | Bacteria | 84320 |
| 241 | Ga0466726_434651 | 3300042619 | Bacteria | 1385 |
| 242 | 2227127470 | 2225789004 | Bacteria | 1674 |
| 243 | 2227512522 | 2225789004 | Bacteria | 694 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.