Protein Family IF01215

Metagenome Metatranscriptome Isolate
391 Members
145 Samples
309 Scaffolds
142.08 Avg Length

🧬 Representative Sequence

ID
3300005083|Ga0068305_10410200|Ga0068305_104102001
Length
171 aa
Sequence
LLLYIRGKPPRTDLFAAKTKPRDYTGRWGKMAKKIAGYVKLQISAGKATPAPPVGPALGQHGVNIMGFCKEFNERTAKDTGLIIPVVITVYADRSFTFITKTPPAAVLLKKACKIESGSGKPNREKVAKISIEEVTKIAEQKMPDLNAASVEAAARMIAGTARSMGIVVE*

πŸ“Š Sample Types

Isolate 21.0%
Metagenome 78.8%
MAG 0.0%
Metatranscriptome 0.3%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 30.0%
Termitidae 25.7%
Kalotermitidae 9.3%
Ixodidae 3.6%
Pyralidae 3.6%
Argasidae 2.9%
Elmidae 2.9%
Drosophilidae 2.1%
Scarabaeidae 2.1%
Passalidae 2.1%
Termopsidae 2.1%
Rhinotermitidae 1.4%
Bombycidae 1.4%
Culicidae 1.4%
Calliphoridae 0.7%
Tenebrionidae 0.7%
Hodotermitidae 0.7%
Nephropidae 0.7%
Ocypodidae 0.7%
Armadillidiidae 0.7%
Noctuidae 0.7%
Eresidae 0.7%
Penaeidae 0.7%
Portunidae 0.7%
Formicidae 0.7%
Curculionidae 0.7%
Euphausiidae 0.7%

🌳 Taxonomy

Archaea 1
Bacteria 360
Eukaryota 0
Viruses 0
Unclassified 30

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
2 2874209778 Francisella tularensis holarctica FT16C-B1 Isolate Ixodidae
3 2506210010 Francisella tularensis tularensis FSC041 Isolate
4 2506210015 Francisella tularensis holarctica FSC185 Isolate
5 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
6 2590828840 Clostridium sp. 2 Isolate Termitidae
7 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
8 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
9 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
10 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
11 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
14 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 637000113 Francisella tularensis tularensis FSC 198 Isolate
18 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
23 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
24 2590828839 Clostridium sp. 1 Isolate Termitidae
25 2791354885 Francisella endosymbiont of Ornithodoros moubata FLE-Om Isolate Argasidae
26 2806310685 Francisella persica ATCC VR-331 Isolate Argasidae
27 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
28 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
29 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
30 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
31 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
32 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
33 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
34 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
35 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
36 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
37 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
38 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
39 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
40 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
41 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
42 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
43 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
44 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
45 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
46 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
47 2871595141 Francisella tularensis 503 Isolate Ixodidae
48 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
49 2788500057 Francisella-like endosymbiont F-Om Isolate Argasidae
50 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
53 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
54 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
55 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
56 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
57 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
58 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
59 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
60 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
61 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
62 2978778678 Bacillus cereus 25 Isolate Ocypodidae
63 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
64 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
65 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
66 2864895409 Bacillus aerius S00152 Isolate Elmidae
67 2916858470 Heyndrickxia oleronia Isolate Unclassified
68 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
69 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
70 2791354884 Francisella endosymbiont of Amblyomma maculatum FLE-Am Isolate Ixodidae
71 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
72 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
73 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
74 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
75 2820450073 Unclassified Firmicutes Lab288P3bin186 Isolate Unclassified
76 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
77 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
78 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
79 8022725327 Bacillus sp. SN10 Isolate Eresidae
80 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
81 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
82 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
83 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
84 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
85 3300005317 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut Metagenome Drosophilidae
86 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
87 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
88 2871564055 Francisella tularensis holarctica FT9C-G7 Isolate Ixodidae
89 2874203443 Francisella tularensis holarctica FT8C-4F Isolate Ixodidae
90 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
91 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
92 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
93 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
94 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
95 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
96 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
97 8064008355 Heyndrickxia oleronia Isolate Unclassified
98 8082023105 Niallia sp. Man26 Isolate Penaeidae
99 2969145278 Bacillus cereus 29 Isolate Portunidae
100 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
101 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
102 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
103 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
104 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
105 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
106 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
107 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
108 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
109 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
110 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
111 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
112 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
113 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
114 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
115 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
116 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
117 2537562000 Bacillus cereus HD73 Isolate Pyralidae
118 2593339124 Clostridium sp. 4 Isolate Termitidae
119 2772190782 Francisella persica ATCC VR-331 Isolate Argasidae
120 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
121 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
122 2820733257 Unclassified Chloroflexi Lab288P4bin59 Isolate Unclassified
123 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
124 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
125 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
126 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
127 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
128 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
129 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
130 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
131 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
132 2864801025 Bacillus aerius S00042 Isolate Elmidae
133 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
134 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
135 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
136 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
137 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
138 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
139 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
140 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
141 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
142 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
143 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
144 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
145 3300023282 Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA Metatranscriptome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_367080 3300042601 Bacteria 19745
2 Ga0466713_042174 3300042602 Bacteria 2829
3 Ga0466716_449387 3300042605 Bacteria 56506
4 Ga0466719_062453 3300042606 Bacteria 18088
5 Ga0466698_101504 3300042610 Bacteria 11573
6 Ga0415639_010033 3300038395 Bacteria 6059
7 Ga0415639_024052 3300038395 Bacteria 14211
8 Ga0415639_156981 3300038395 Bacteria 1804
9 Ga0415639_202281 3300038395 Bacteria 1103
10 Ga0466657_221898 3300042582 Bacteria 3544
11 Ga0466691_018487 3300042593 Bacteria 80759
12 Ga0466691_195434 3300042593 Bacteria 3019
13 Ga0123357_10592082 3300009784 Bacteria 857
14 Ga0123357_10700602 3300009784 Bacteria 726
15 Ga0123355_10030462 3300009826 Bacteria 8744
16 Ga0123355_11025490 3300009826 Unclassified 872
17 Ga0123355_11493912 3300009826 Bacteria 660
18 Ga0123356_10227831 3300010049 Bacteria 1925
19 Ga0123356_10970682 3300010049 Bacteria 1020
20 Ga0123353_10217310 3300010167 Bacteria 2993
21 Ga0123353_10397428 3300010167 Bacteria 2053
22 Ga0123353_11162142 3300010167 Bacteria 1017
23 Ga0123353_11497097 3300010167 Bacteria 860
24 2227524621 2225789004 Bacteria 16977
25 IMNBL1DRAFT_c0001883 3300000062 Bacteria 15269
26 IMNBL1DRAFT_c0002473 3300000062 Bacteria 12843
27 IMNBL1DRAFT_c0009505 3300000062 Bacteria 4791
28 Ga0068305_10023178 3300005083 Bacteria 9105
29 Ga0074311_1149509 3300005317 Bacteria 1061
30 Ga0466715_160590 3300042616 Bacteria 34416
31 Ga0466723_023303 3300042618 Bacteria 17662
32 Ga0466729_312144 3300042621 Bacteria 3207
33 Ga0466703_203636 3300042636 Bacteria 30259
34 Ga0466703_296081 3300042636 Bacteria 8774
35 Ga0466703_343356 3300042636 Bacteria 46819
36 Ga0466703_373746 3300042636 Bacteria 41397
37 Ga0466704_000461 3300042643 Unclassified 3065
38 Ga0466725_181096 3300042654 Bacteria 9862
39 Ga0466700_318811 3300042600 Bacteria 1370
40 Ga0466714_062311 3300042603 Bacteria 2984
41 Ga0466717_146529 3300042604 Bacteria 1934
42 Ga0466716_400847 3300042605 Bacteria 3529
43 Ga0466719_382908 3300042606 Bacteria 3141
44 Ga0415639_015003 3300038395 Bacteria 22712
45 Ga0466695_182539 3300042595 Bacteria 3552
46 Ga0466696_357208 3300042596 Bacteria 5389
47 Ga0123357_10151357 3300009784 Bacteria 2814
48 Ga0123357_10432928 3300009784 Bacteria 1160
49 Ga0123355_10175942 3300009826 Bacteria 3187
50 Ga0123355_10735057 3300009826 Bacteria 1121
51 Ga0123356_10005815 3300010049 Bacteria 12519
52 Ga0123356_10318373 3300010049 Bacteria 1668
53 Ga0123356_10978849 3300010049 Bacteria 1016
54 Ga0123356_11147522 3300010049 Bacteria 944
55 Ga0123356_12283052 3300010049 Bacteria 676
56 Ga0123356_12870405 3300010049 Bacteria 603
57 Ga0123353_10000065 3300010167 Bacteria 116079
58 Ga0123353_10002919 3300010167 Bacteria 21406
59 Ga0123353_11281670 3300010167 Bacteria 953
60 Ga0123353_11464049 3300010167 Bacteria 873
61 Ga0466705_007537 3300042612 Bacteria 9476
62 2227464840 2225789004 Bacteria 980
63 2227480184 2225789004 Bacteria 78831
64 IMNBL1DRAFT_c0106343 3300000062 Bacteria 749
65 JGI24702J35022_10530000 3300002462 Unclassified 724
66 Ga0072941_1081391 3300005201 Bacteria 8066
67 Ga0466711_295083 3300042615 Bacteria 5937
68 Ga0466715_144518 3300042616 Bacteria 3291
69 Ga0466715_586554 3300042616 Bacteria 2830
70 Ga0466718_089509 3300042617 Bacteria 46037
71 Ga0466723_124886 3300042618 Bacteria 2899
72 Ga0466726_071287 3300042619 Bacteria 39848
73 Ga0466726_463981 3300042619 Bacteria 1942
74 Ga0466728_454232 3300042620 Unclassified 1331
75 Ga0466734_152129 3300042623 Bacteria 1103
76 Ga0466735_045620 3300042624 Bacteria 1135
77 Ga0466735_208302 3300042624 Bacteria 2005
78 Ga0466730_044605 3300042625 Bacteria 3445
79 Ga0466702_140007 3300042635 Bacteria 37921
80 Ga0466703_129736 3300042636 Bacteria 2615
81 Ga0466703_395909 3300042636 Unclassified 14309
82 Ga0466704_293029 3300042643 Bacteria 8824
83 Ga0466704_447828 3300042643 Bacteria 1192
84 Ga0466725_447152 3300042654 Unclassified 1058
85 Ga0466700_136186 3300042600 Bacteria 1564
86 Ga0466714_094251 3300042603 Unclassified 1039
87 Ga0466719_194200 3300042606 Bacteria 19015
88 Ga0466719_570609 3300042606 Bacteria 2796
89 Ga0466721_044867 3300042608 Bacteria 1419
90 Ga0160447_112318 3300012849 Bacteria 1749
91 Ga0466693_222030 3300042592 Unclassified 1593
92 Ga0123355_10006889 3300009826 Bacteria 16925
93 Ga0123355_10116985 3300009826 Unclassified 4146
94 Ga0123355_10176018 3300009826 Bacteria 3186
95 Ga0123355_10199294 3300009826 Unclassified 2929
96 Ga0123355_10231039 3300009826 Bacteria 2641
97 Ga0123355_10290190 3300009826 Bacteria 2246
98 Ga0123356_10003524 3300010049 Bacteria 16371
99 Ga0123353_10000165 3300010167 Bacteria 83897
100 Ga0123353_10054451 3300010167 Bacteria 6397
101 Ga0123353_10399971 3300010167 Bacteria 2045
102 Ga0123353_10578050 3300010167 Bacteria 1613
103 Ga0123353_11037037 3300010167 Unclassified 1097
104 Ga0123354_10458674 3300010882 Unclassified 1026
105 Ga0466705_206391 3300042612 Bacteria 1595
106 Ga0466727_350481 3300042655 Bacteria 2154
107 2227509388 2225789004 Bacteria 3595
108 JGI24702J35022_10028176 3300002462 Bacteria 3020
109 JGI24702J35022_10394852 3300002462 Bacteria 834
110 JGI24703J35330_11739395 3300002501 Bacteria 3293
111 Ga0466715_210301 3300042616 Bacteria 20552
112 Ga0466715_451250 3300042616 Bacteria 1828
113 Ga0466726_232104 3300042619 Bacteria 6281
114 Ga0466726_289034 3300042619 Bacteria 1570
115 Ga0466703_175992 3300042636 Bacteria 111016
116 Ga0466703_259253 3300042636 Bacteria 15681
117 Ga0466700_316696 3300042600 Bacteria 1026
118 Ga0466700_411547 3300042600 Bacteria 3818
119 Ga0466700_432787 3300042600 Bacteria 1041
120 Ga0466722_143414 3300042609 Bacteria 67795
121 Ga0466722_258265 3300042609 Bacteria 6908
122 Ga0415639_004921 3300038395 Bacteria 1189
123 Ga0415639_021202 3300038395 Bacteria 1934
124 Ga0415639_041464 3300038395 Bacteria 2891
125 Ga0466656_023813 3300042550 Bacteria 1584
126 Ga0466696_117413 3300042596 Bacteria 28050
127 Ga0123357_10203510 3300009784 Unclassified 2246
128 Ga0123355_10088014 3300009826 Bacteria 4934
129 Ga0123355_10090634 3300009826 Bacteria 4849
130 Ga0123355_10416100 3300009826 Archaea 1722
131 Ga0123355_11458482 3300009826 Bacteria 671
132 Ga0123356_10260507 3300010049 Bacteria 1818
133 Ga0123356_10275425 3300010049 Bacteria 1775
134 Ga0123356_10292056 3300010049 Bacteria 1731
135 Ga0123356_11675363 3300010049 Bacteria 788
136 Ga0123356_11758439 3300010049 Bacteria 770
137 Ga0123353_10029742 3300010167 Bacteria 8426
138 Ga0123353_10240676 3300010167 Bacteria 2812
139 Ga0123353_10659422 3300010167 Bacteria 1479
140 Ga0123353_10745380 3300010167 Bacteria 1364
141 Ga0123353_10820140 3300010167 Bacteria 1281
142 Ga0466697_165348 3300042611 Bacteria 4222
143 Ga0466705_079289 3300042612 Bacteria 1506
144 Ga0466705_249892 3300042612 Bacteria 2614
145 IMNBGM34_c006661 3300000036 Bacteria 1495
146 JGI24702J35022_10000123 3300002462 Bacteria 37729
147 Ga0466715_558368 3300042616 Bacteria 2675
148 Ga0466718_071061 3300042617 Bacteria 2038
149 Ga0466735_189014 3300042624 Bacteria 1000
150 Ga0466702_369338 3300042635 Unclassified 1183
151 Ga0466703_326813 3300042636 Bacteria 78531
152 Ga0466724_48169 3300042649 Bacteria 2048
153 Ga0466727_174866 3300042655 Bacteria 1640
154 Ga0466706_216729 3300042599 Bacteria 2893
155 Ga0466714_022376 3300042603 Bacteria 1206
156 Ga0466714_080576 3300042603 Bacteria 5255
157 Ga0466722_107443 3300042609 Bacteria 1676
158 Ga0466698_026641 3300042610 Bacteria 1263
159 Ga0466694_138987 3300042594 Bacteria 2239
160 Ga0123357_10176123 3300009784 Unclassified 2514
161 Ga0123357_10182603 3300009784 Bacteria 2444
162 Ga0123357_10466999 3300009784 Bacteria 1079
163 Ga0123355_10201572 3300009826 Bacteria 2905
164 Ga0123355_10982031 3300009826 Bacteria 900
165 Ga0123355_11041761 3300009826 Unclassified 861
166 Ga0123356_10052899 3300010049 Bacteria 3778
167 Ga0123356_12313256 3300010049 Bacteria 672
168 Ga0123356_12321896 3300010049 Bacteria 671
169 Ga0123353_10067871 3300010167 Bacteria 5727
170 Ga0123353_10068514 3300010167 Bacteria 5699
171 Ga0123353_10160254 3300010167 Bacteria 3583
172 Ga0123353_10329807 3300010167 Bacteria 2311
173 Ga0123353_10332490 3300010167 Bacteria 2299
174 Ga0123353_10393325 3300010167 Bacteria 2067
175 Ga0123353_10886807 3300010167 Bacteria 1217
176 Ga0123353_12001684 3300010167 Bacteria 710
177 Ga0123353_12177679 3300010167 Bacteria 672
178 Ga0123354_10209769 3300010882 Bacteria 2109
179 Ga0466705_013522 3300042612 Bacteria 8655
180 Ga0466705_197616 3300042612 Bacteria 10619
181 Ga0530661_000022 3300056564 Bacteria 194089
182 IMNBL1DRAFT_c0042784 3300000062 Bacteria 1506
183 IMNBL1DRAFT_c0043233 3300000062 Bacteria 1493
184 JGI24695J34938_10296487 3300002450 Bacteria 698
185 JGI24702J35022_10001115 3300002462 Bacteria 16664
186 JGI24702J35022_10263820 3300002462 Bacteria 1006
187 Ga0063521_1000130 3300003973 Bacteria 58438
188 Ga0072941_1005122 3300005201 Bacteria 10650
189 Ga0072941_1103278 3300005201 Bacteria 963
190 Ga0466711_280228 3300042615 Bacteria 44420
191 Ga0466715_387240 3300042616 Bacteria 1977
192 Ga0466715_505567 3300042616 Bacteria 13324
193 Ga0466730_058855 3300042625 Bacteria 1942
194 Ga0466703_085348 3300042636 Bacteria 2107
195 Ga0466704_332321 3300042643 Unclassified 2518
196 Ga0466704_546879 3300042643 Bacteria 1716
197 Ga0466706_012779 3300042599 Bacteria 4798
198 Ga0466706_029850 3300042599 Bacteria 4392
199 Ga0466714_087172 3300042603 Bacteria 1993
200 Ga0466714_105059 3300042603 Bacteria 1866
201 Ga0466714_139014 3300042603 Unclassified 1441
202 Ga0466722_232480 3300042609 Bacteria 4914
203 Ga0255808_1117784 3300023282 Bacteria 515
204 Ga0415639_074308 3300038395 Bacteria 2471
205 Ga0466657_148573 3300042582 Bacteria 3396
206 Ga0466694_232943 3300042594 Bacteria 5152
207 Ga0466696_021612 3300042596 Bacteria 64353
208 Ga0123357_10862332 3300009784 Bacteria 595
209 Ga0123355_10029292 3300009826 Bacteria 8910
210 Ga0123355_10042955 3300009826 Bacteria 7355
211 Ga0123355_10623654 3300009826 Bacteria 1270
212 Ga0123355_10695726 3300009826 Bacteria 1169
213 Ga0123355_11824167 3300009826 Bacteria 572
214 Ga0123356_10186091 3300010049 Bacteria 2103
215 Ga0123356_10294017 3300010049 Bacteria 1726
216 Ga0123356_11640237 3300010049 Bacteria 797
217 Ga0123353_10046443 3300010167 Bacteria 6901
218 Ga0123353_10143921 3300010167 Bacteria 3815
219 Ga0123353_10272409 3300010167 Bacteria 2607
220 Ga0123353_10485648 3300010167 Bacteria 1806
221 Ga0123353_11004620 3300010167 Bacteria 1120
222 Ga0123353_11142010 3300010167 Bacteria 1029
223 Ga0123353_11939220 3300010167 Bacteria 725
224 Ga0123353_12222122 3300010167 Unclassified 663
225 Ga0123354_10327454 3300010882 Bacteria 1403
226 Ga0466705_152746 3300042612 Bacteria 12114
227 Ga0466733_203141 3300042659 Bacteria 2088
228 IMNBL1DRAFT_c0000422 3300000062 Bacteria 35538
229 JGI24705J35276_12134200 3300002504 Bacteria 1115
230 Ga0068305_10410200 3300005083 Bacteria 1322
231 Ga0466711_165617 3300042615 Bacteria 2870
232 Ga0466715_538227 3300042616 Bacteria 4048
233 Ga0466723_050061 3300042618 Bacteria 2813
234 Ga0466731_087692 3300042622 Bacteria 2713
235 Ga0466704_270296 3300042643 Bacteria 7849
236 Ga0466704_611680 3300042643 Bacteria 3571
237 Ga0466725_203691 3300042654 Bacteria 1785
238 Ga0466707_256875 3300042601 Bacteria 1812
239 Ga0466707_366979 3300042601 Bacteria 1735
240 Ga0466714_095524 3300042603 Bacteria 1910
241 Ga0466717_146018 3300042604 Bacteria 11162
242 Ga0466716_283921 3300042605 Bacteria 44945
243 Ga0466719_256497 3300042606 Unclassified 32064
244 Ga0466719_488335 3300042606 Bacteria 2620
245 Ga0415639_038553 3300038395 Bacteria 3339
246 Ga0466690_267354 3300042590 Bacteria 70233
247 Ga0123357_10515109 3300009784 Bacteria 982
248 Ga0123355_10019670 3300009826 Bacteria 10754
249 Ga0123356_10454808 3300010049 Bacteria 1429
250 Ga0123356_10999816 3300010049 Bacteria 1006
251 Ga0123356_11855055 3300010049 Bacteria 750
252 Ga0123356_12238523 3300010049 Unclassified 683
253 Ga0123353_10033919 3300010167 Bacteria 7956
254 Ga0123353_10065975 3300010167 Bacteria 5810
255 Ga0123353_10157619 3300010167 Bacteria 3617
256 Ga0123353_10172454 3300010167 Bacteria 3432
257 Ga0123353_10321907 3300010167 Bacteria 2346
258 Ga0123353_10639962 3300010167 Unclassified 1508
259 Ga0123353_10997165 3300010167 Bacteria 1126
260 Ga0123353_11201337 3300010167 Bacteria 995
261 Ga0123353_11554752 3300010167 Bacteria 839
262 Ga0123353_11822296 3300010167 Bacteria 755
263 Ga0123354_10051566 3300010882 Bacteria 6210
264 Ga0466705_309878 3300042612 Bacteria 1580
265 JGI24705J35276_12234253 3300002504 Bacteria 5368
266 JGI24696J40584_12945093 3300002834 Unclassified 1838
267 Ga0068305_11083671 3300005083 Bacteria 937
268 Ga0466715_308526 3300042616 Unclassified 4222
269 Ga0466715_356120 3300042616 Bacteria 15074
270 Ga0466723_130713 3300042618 Bacteria 2872
271 Ga0466728_374321 3300042620 Bacteria 2817
272 Ga0466729_287045 3300042621 Bacteria 99069
273 Ga0466729_290191 3300042621 Bacteria 5243
274 Ga0466704_252842 3300042643 Unclassified 1202
275 Ga0466727_124929 3300042655 Bacteria 1108
276 Ga0466701_055327 3300042598 Bacteria 1463
277 Ga0466714_020081 3300042603 Bacteria 30959
278 Ga0466714_133706 3300042603 Bacteria 11876
279 Ga0466719_376575 3300042606 Unclassified 7574
280 Ga0466719_523800 3300042606 Bacteria 8558
281 Ga0466722_156728 3300042609 Bacteria 1605
282 Ga0466722_167803 3300042609 Bacteria 4883
283 Ga0160433_116830 3300012846 Bacteria 886
284 Ga0415639_027036 3300038395 Bacteria 1469
285 Ga0466690_270374 3300042590 Bacteria 1125
286 Ga0466691_060644 3300042593 Unclassified 41696
287 Ga0123357_10302173 3300009784 Bacteria 1614
288 Ga0123355_10152341 3300009826 Bacteria 3509
289 Ga0123355_10320249 3300009826 Bacteria 2090
290 Ga0123355_11900633 3300009826 Bacteria 556
291 Ga0123356_10133491 3300010049 Bacteria 2436
292 Ga0123356_10593745 3300010049 Bacteria 1271
293 Ga0123356_10626706 3300010049 Bacteria 1241
294 Ga0123356_11351558 3300010049 Bacteria 874
295 Ga0123353_10165320 3300010167 Bacteria 3518
296 Ga0123353_10893241 3300010167 Bacteria 1211
297 Ga0123353_11266970 3300010167 Unclassified 961
298 Ga0123353_12949843 3300010167 Unclassified 553
299 Ga0123354_10149949 3300010882 Bacteria 2831
300 Ga0123354_10672592 3300010882 Unclassified 732
301 Ga0466697_103655 3300042611 Bacteria 12616
302 Ga0466733_075055 3300042659 Bacteria 6809
303 JGI24703J35330_11318491 3300002501 Bacteria 867
304 Ga0072941_1103277 3300005201 Bacteria 2521
305 Ga0466715_042181 3300042616 Bacteria 63725
306 Ga0466718_163165 3300042617 Bacteria 1212
307 Ga0466729_287781 3300042621 Bacteria 1114
308 Ga0466704_474959 3300042643 Bacteria 73122
309 Ga0466708_395453 3300042652 Bacteria 19642

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain 39 96 0.99
PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain 101 169 0.99

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.