Protein Family IF01215
Metagenome
Metatranscriptome
Isolate
391
Members
145
Samples
309
Scaffolds
142.08
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10410200|Ga0068305_104102001
- Length
- 171 aa
- Sequence
- LLLYIRGKPPRTDLFAAKTKPRDYTGRWGKMAKKIAGYVKLQISAGKATPAPPVGPALGQHGVNIMGFCKEFNERTAKDTGLIIPVVITVYADRSFTFITKTPPAAVLLKKACKIESGSGKPNREKVAKISIEEVTKIAEQKMPDLNAASVEAAARMIAGTARSMGIVVE*
Sample Types
Isolate
21.0%
Metagenome
78.8%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.0%
Termitidae
25.7%
Kalotermitidae
9.3%
Ixodidae
3.6%
Pyralidae
3.6%
Argasidae
2.9%
Elmidae
2.9%
Drosophilidae
2.1%
Scarabaeidae
2.1%
Passalidae
2.1%
Termopsidae
2.1%
Rhinotermitidae
1.4%
Bombycidae
1.4%
Culicidae
1.4%
Calliphoridae
0.7%
Tenebrionidae
0.7%
Hodotermitidae
0.7%
Nephropidae
0.7%
Ocypodidae
0.7%
Armadillidiidae
0.7%
Noctuidae
0.7%
Eresidae
0.7%
Penaeidae
0.7%
Portunidae
0.7%
Formicidae
0.7%
Curculionidae
0.7%
Euphausiidae
0.7%
Taxonomy
Archaea
1
Bacteria
360
Eukaryota
0
Viruses
0
Unclassified
30
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 2 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 3 | 2506210010 | Francisella tularensis tularensis FSC041 | Isolate | |
| 4 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 5 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 6 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 7 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 8 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 9 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 10 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 11 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 14 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 17 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 18 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 23 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 24 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 25 | 2791354885 | Francisella endosymbiont of Ornithodoros moubata FLE-Om | Isolate | Argasidae |
| 26 | 2806310685 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 27 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 28 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 29 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 30 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 31 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 34 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 40 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 41 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 45 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 46 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 47 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 48 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 49 | 2788500057 | Francisella-like endosymbiont F-Om | Isolate | Argasidae |
| 50 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 53 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 54 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 55 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 56 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 57 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 58 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 59 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 60 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 61 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 62 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 63 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 64 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 65 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 66 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 67 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 68 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 69 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 70 | 2791354884 | Francisella endosymbiont of Amblyomma maculatum FLE-Am | Isolate | Ixodidae |
| 71 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 72 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 73 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 74 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 75 | 2820450073 | Unclassified Firmicutes Lab288P3bin186 | Isolate | Unclassified |
| 76 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 77 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 78 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 79 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 80 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 81 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 82 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 83 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 84 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 85 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 86 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 87 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 88 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 89 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 90 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 91 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 92 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 93 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 94 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 95 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 96 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 97 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 98 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 99 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 100 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 101 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 102 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 103 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 104 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 105 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 106 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 107 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 108 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 109 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 110 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 111 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 112 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 113 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 114 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 115 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 116 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 117 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 118 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 119 | 2772190782 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 120 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 121 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 122 | 2820733257 | Unclassified Chloroflexi Lab288P4bin59 | Isolate | Unclassified |
| 123 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 124 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 125 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 126 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 127 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 128 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 129 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 130 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 131 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 132 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 133 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 134 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 135 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 136 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 137 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 138 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 139 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 140 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 141 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 142 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 143 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 144 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 145 | 3300023282 | Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_367080 | 3300042601 | Bacteria | 19745 |
| 2 | Ga0466713_042174 | 3300042602 | Bacteria | 2829 |
| 3 | Ga0466716_449387 | 3300042605 | Bacteria | 56506 |
| 4 | Ga0466719_062453 | 3300042606 | Bacteria | 18088 |
| 5 | Ga0466698_101504 | 3300042610 | Bacteria | 11573 |
| 6 | Ga0415639_010033 | 3300038395 | Bacteria | 6059 |
| 7 | Ga0415639_024052 | 3300038395 | Bacteria | 14211 |
| 8 | Ga0415639_156981 | 3300038395 | Bacteria | 1804 |
| 9 | Ga0415639_202281 | 3300038395 | Bacteria | 1103 |
| 10 | Ga0466657_221898 | 3300042582 | Bacteria | 3544 |
| 11 | Ga0466691_018487 | 3300042593 | Bacteria | 80759 |
| 12 | Ga0466691_195434 | 3300042593 | Bacteria | 3019 |
| 13 | Ga0123357_10592082 | 3300009784 | Bacteria | 857 |
| 14 | Ga0123357_10700602 | 3300009784 | Bacteria | 726 |
| 15 | Ga0123355_10030462 | 3300009826 | Bacteria | 8744 |
| 16 | Ga0123355_11025490 | 3300009826 | Unclassified | 872 |
| 17 | Ga0123355_11493912 | 3300009826 | Bacteria | 660 |
| 18 | Ga0123356_10227831 | 3300010049 | Bacteria | 1925 |
| 19 | Ga0123356_10970682 | 3300010049 | Bacteria | 1020 |
| 20 | Ga0123353_10217310 | 3300010167 | Bacteria | 2993 |
| 21 | Ga0123353_10397428 | 3300010167 | Bacteria | 2053 |
| 22 | Ga0123353_11162142 | 3300010167 | Bacteria | 1017 |
| 23 | Ga0123353_11497097 | 3300010167 | Bacteria | 860 |
| 24 | 2227524621 | 2225789004 | Bacteria | 16977 |
| 25 | IMNBL1DRAFT_c0001883 | 3300000062 | Bacteria | 15269 |
| 26 | IMNBL1DRAFT_c0002473 | 3300000062 | Bacteria | 12843 |
| 27 | IMNBL1DRAFT_c0009505 | 3300000062 | Bacteria | 4791 |
| 28 | Ga0068305_10023178 | 3300005083 | Bacteria | 9105 |
| 29 | Ga0074311_1149509 | 3300005317 | Bacteria | 1061 |
| 30 | Ga0466715_160590 | 3300042616 | Bacteria | 34416 |
| 31 | Ga0466723_023303 | 3300042618 | Bacteria | 17662 |
| 32 | Ga0466729_312144 | 3300042621 | Bacteria | 3207 |
| 33 | Ga0466703_203636 | 3300042636 | Bacteria | 30259 |
| 34 | Ga0466703_296081 | 3300042636 | Bacteria | 8774 |
| 35 | Ga0466703_343356 | 3300042636 | Bacteria | 46819 |
| 36 | Ga0466703_373746 | 3300042636 | Bacteria | 41397 |
| 37 | Ga0466704_000461 | 3300042643 | Unclassified | 3065 |
| 38 | Ga0466725_181096 | 3300042654 | Bacteria | 9862 |
| 39 | Ga0466700_318811 | 3300042600 | Bacteria | 1370 |
| 40 | Ga0466714_062311 | 3300042603 | Bacteria | 2984 |
| 41 | Ga0466717_146529 | 3300042604 | Bacteria | 1934 |
| 42 | Ga0466716_400847 | 3300042605 | Bacteria | 3529 |
| 43 | Ga0466719_382908 | 3300042606 | Bacteria | 3141 |
| 44 | Ga0415639_015003 | 3300038395 | Bacteria | 22712 |
| 45 | Ga0466695_182539 | 3300042595 | Bacteria | 3552 |
| 46 | Ga0466696_357208 | 3300042596 | Bacteria | 5389 |
| 47 | Ga0123357_10151357 | 3300009784 | Bacteria | 2814 |
| 48 | Ga0123357_10432928 | 3300009784 | Bacteria | 1160 |
| 49 | Ga0123355_10175942 | 3300009826 | Bacteria | 3187 |
| 50 | Ga0123355_10735057 | 3300009826 | Bacteria | 1121 |
| 51 | Ga0123356_10005815 | 3300010049 | Bacteria | 12519 |
| 52 | Ga0123356_10318373 | 3300010049 | Bacteria | 1668 |
| 53 | Ga0123356_10978849 | 3300010049 | Bacteria | 1016 |
| 54 | Ga0123356_11147522 | 3300010049 | Bacteria | 944 |
| 55 | Ga0123356_12283052 | 3300010049 | Bacteria | 676 |
| 56 | Ga0123356_12870405 | 3300010049 | Bacteria | 603 |
| 57 | Ga0123353_10000065 | 3300010167 | Bacteria | 116079 |
| 58 | Ga0123353_10002919 | 3300010167 | Bacteria | 21406 |
| 59 | Ga0123353_11281670 | 3300010167 | Bacteria | 953 |
| 60 | Ga0123353_11464049 | 3300010167 | Bacteria | 873 |
| 61 | Ga0466705_007537 | 3300042612 | Bacteria | 9476 |
| 62 | 2227464840 | 2225789004 | Bacteria | 980 |
| 63 | 2227480184 | 2225789004 | Bacteria | 78831 |
| 64 | IMNBL1DRAFT_c0106343 | 3300000062 | Bacteria | 749 |
| 65 | JGI24702J35022_10530000 | 3300002462 | Unclassified | 724 |
| 66 | Ga0072941_1081391 | 3300005201 | Bacteria | 8066 |
| 67 | Ga0466711_295083 | 3300042615 | Bacteria | 5937 |
| 68 | Ga0466715_144518 | 3300042616 | Bacteria | 3291 |
| 69 | Ga0466715_586554 | 3300042616 | Bacteria | 2830 |
| 70 | Ga0466718_089509 | 3300042617 | Bacteria | 46037 |
| 71 | Ga0466723_124886 | 3300042618 | Bacteria | 2899 |
| 72 | Ga0466726_071287 | 3300042619 | Bacteria | 39848 |
| 73 | Ga0466726_463981 | 3300042619 | Bacteria | 1942 |
| 74 | Ga0466728_454232 | 3300042620 | Unclassified | 1331 |
| 75 | Ga0466734_152129 | 3300042623 | Bacteria | 1103 |
| 76 | Ga0466735_045620 | 3300042624 | Bacteria | 1135 |
| 77 | Ga0466735_208302 | 3300042624 | Bacteria | 2005 |
| 78 | Ga0466730_044605 | 3300042625 | Bacteria | 3445 |
| 79 | Ga0466702_140007 | 3300042635 | Bacteria | 37921 |
| 80 | Ga0466703_129736 | 3300042636 | Bacteria | 2615 |
| 81 | Ga0466703_395909 | 3300042636 | Unclassified | 14309 |
| 82 | Ga0466704_293029 | 3300042643 | Bacteria | 8824 |
| 83 | Ga0466704_447828 | 3300042643 | Bacteria | 1192 |
| 84 | Ga0466725_447152 | 3300042654 | Unclassified | 1058 |
| 85 | Ga0466700_136186 | 3300042600 | Bacteria | 1564 |
| 86 | Ga0466714_094251 | 3300042603 | Unclassified | 1039 |
| 87 | Ga0466719_194200 | 3300042606 | Bacteria | 19015 |
| 88 | Ga0466719_570609 | 3300042606 | Bacteria | 2796 |
| 89 | Ga0466721_044867 | 3300042608 | Bacteria | 1419 |
| 90 | Ga0160447_112318 | 3300012849 | Bacteria | 1749 |
| 91 | Ga0466693_222030 | 3300042592 | Unclassified | 1593 |
| 92 | Ga0123355_10006889 | 3300009826 | Bacteria | 16925 |
| 93 | Ga0123355_10116985 | 3300009826 | Unclassified | 4146 |
| 94 | Ga0123355_10176018 | 3300009826 | Bacteria | 3186 |
| 95 | Ga0123355_10199294 | 3300009826 | Unclassified | 2929 |
| 96 | Ga0123355_10231039 | 3300009826 | Bacteria | 2641 |
| 97 | Ga0123355_10290190 | 3300009826 | Bacteria | 2246 |
| 98 | Ga0123356_10003524 | 3300010049 | Bacteria | 16371 |
| 99 | Ga0123353_10000165 | 3300010167 | Bacteria | 83897 |
| 100 | Ga0123353_10054451 | 3300010167 | Bacteria | 6397 |
| 101 | Ga0123353_10399971 | 3300010167 | Bacteria | 2045 |
| 102 | Ga0123353_10578050 | 3300010167 | Bacteria | 1613 |
| 103 | Ga0123353_11037037 | 3300010167 | Unclassified | 1097 |
| 104 | Ga0123354_10458674 | 3300010882 | Unclassified | 1026 |
| 105 | Ga0466705_206391 | 3300042612 | Bacteria | 1595 |
| 106 | Ga0466727_350481 | 3300042655 | Bacteria | 2154 |
| 107 | 2227509388 | 2225789004 | Bacteria | 3595 |
| 108 | JGI24702J35022_10028176 | 3300002462 | Bacteria | 3020 |
| 109 | JGI24702J35022_10394852 | 3300002462 | Bacteria | 834 |
| 110 | JGI24703J35330_11739395 | 3300002501 | Bacteria | 3293 |
| 111 | Ga0466715_210301 | 3300042616 | Bacteria | 20552 |
| 112 | Ga0466715_451250 | 3300042616 | Bacteria | 1828 |
| 113 | Ga0466726_232104 | 3300042619 | Bacteria | 6281 |
| 114 | Ga0466726_289034 | 3300042619 | Bacteria | 1570 |
| 115 | Ga0466703_175992 | 3300042636 | Bacteria | 111016 |
| 116 | Ga0466703_259253 | 3300042636 | Bacteria | 15681 |
| 117 | Ga0466700_316696 | 3300042600 | Bacteria | 1026 |
| 118 | Ga0466700_411547 | 3300042600 | Bacteria | 3818 |
| 119 | Ga0466700_432787 | 3300042600 | Bacteria | 1041 |
| 120 | Ga0466722_143414 | 3300042609 | Bacteria | 67795 |
| 121 | Ga0466722_258265 | 3300042609 | Bacteria | 6908 |
| 122 | Ga0415639_004921 | 3300038395 | Bacteria | 1189 |
| 123 | Ga0415639_021202 | 3300038395 | Bacteria | 1934 |
| 124 | Ga0415639_041464 | 3300038395 | Bacteria | 2891 |
| 125 | Ga0466656_023813 | 3300042550 | Bacteria | 1584 |
| 126 | Ga0466696_117413 | 3300042596 | Bacteria | 28050 |
| 127 | Ga0123357_10203510 | 3300009784 | Unclassified | 2246 |
| 128 | Ga0123355_10088014 | 3300009826 | Bacteria | 4934 |
| 129 | Ga0123355_10090634 | 3300009826 | Bacteria | 4849 |
| 130 | Ga0123355_10416100 | 3300009826 | Archaea | 1722 |
| 131 | Ga0123355_11458482 | 3300009826 | Bacteria | 671 |
| 132 | Ga0123356_10260507 | 3300010049 | Bacteria | 1818 |
| 133 | Ga0123356_10275425 | 3300010049 | Bacteria | 1775 |
| 134 | Ga0123356_10292056 | 3300010049 | Bacteria | 1731 |
| 135 | Ga0123356_11675363 | 3300010049 | Bacteria | 788 |
| 136 | Ga0123356_11758439 | 3300010049 | Bacteria | 770 |
| 137 | Ga0123353_10029742 | 3300010167 | Bacteria | 8426 |
| 138 | Ga0123353_10240676 | 3300010167 | Bacteria | 2812 |
| 139 | Ga0123353_10659422 | 3300010167 | Bacteria | 1479 |
| 140 | Ga0123353_10745380 | 3300010167 | Bacteria | 1364 |
| 141 | Ga0123353_10820140 | 3300010167 | Bacteria | 1281 |
| 142 | Ga0466697_165348 | 3300042611 | Bacteria | 4222 |
| 143 | Ga0466705_079289 | 3300042612 | Bacteria | 1506 |
| 144 | Ga0466705_249892 | 3300042612 | Bacteria | 2614 |
| 145 | IMNBGM34_c006661 | 3300000036 | Bacteria | 1495 |
| 146 | JGI24702J35022_10000123 | 3300002462 | Bacteria | 37729 |
| 147 | Ga0466715_558368 | 3300042616 | Bacteria | 2675 |
| 148 | Ga0466718_071061 | 3300042617 | Bacteria | 2038 |
| 149 | Ga0466735_189014 | 3300042624 | Bacteria | 1000 |
| 150 | Ga0466702_369338 | 3300042635 | Unclassified | 1183 |
| 151 | Ga0466703_326813 | 3300042636 | Bacteria | 78531 |
| 152 | Ga0466724_48169 | 3300042649 | Bacteria | 2048 |
| 153 | Ga0466727_174866 | 3300042655 | Bacteria | 1640 |
| 154 | Ga0466706_216729 | 3300042599 | Bacteria | 2893 |
| 155 | Ga0466714_022376 | 3300042603 | Bacteria | 1206 |
| 156 | Ga0466714_080576 | 3300042603 | Bacteria | 5255 |
| 157 | Ga0466722_107443 | 3300042609 | Bacteria | 1676 |
| 158 | Ga0466698_026641 | 3300042610 | Bacteria | 1263 |
| 159 | Ga0466694_138987 | 3300042594 | Bacteria | 2239 |
| 160 | Ga0123357_10176123 | 3300009784 | Unclassified | 2514 |
| 161 | Ga0123357_10182603 | 3300009784 | Bacteria | 2444 |
| 162 | Ga0123357_10466999 | 3300009784 | Bacteria | 1079 |
| 163 | Ga0123355_10201572 | 3300009826 | Bacteria | 2905 |
| 164 | Ga0123355_10982031 | 3300009826 | Bacteria | 900 |
| 165 | Ga0123355_11041761 | 3300009826 | Unclassified | 861 |
| 166 | Ga0123356_10052899 | 3300010049 | Bacteria | 3778 |
| 167 | Ga0123356_12313256 | 3300010049 | Bacteria | 672 |
| 168 | Ga0123356_12321896 | 3300010049 | Bacteria | 671 |
| 169 | Ga0123353_10067871 | 3300010167 | Bacteria | 5727 |
| 170 | Ga0123353_10068514 | 3300010167 | Bacteria | 5699 |
| 171 | Ga0123353_10160254 | 3300010167 | Bacteria | 3583 |
| 172 | Ga0123353_10329807 | 3300010167 | Bacteria | 2311 |
| 173 | Ga0123353_10332490 | 3300010167 | Bacteria | 2299 |
| 174 | Ga0123353_10393325 | 3300010167 | Bacteria | 2067 |
| 175 | Ga0123353_10886807 | 3300010167 | Bacteria | 1217 |
| 176 | Ga0123353_12001684 | 3300010167 | Bacteria | 710 |
| 177 | Ga0123353_12177679 | 3300010167 | Bacteria | 672 |
| 178 | Ga0123354_10209769 | 3300010882 | Bacteria | 2109 |
| 179 | Ga0466705_013522 | 3300042612 | Bacteria | 8655 |
| 180 | Ga0466705_197616 | 3300042612 | Bacteria | 10619 |
| 181 | Ga0530661_000022 | 3300056564 | Bacteria | 194089 |
| 182 | IMNBL1DRAFT_c0042784 | 3300000062 | Bacteria | 1506 |
| 183 | IMNBL1DRAFT_c0043233 | 3300000062 | Bacteria | 1493 |
| 184 | JGI24695J34938_10296487 | 3300002450 | Bacteria | 698 |
| 185 | JGI24702J35022_10001115 | 3300002462 | Bacteria | 16664 |
| 186 | JGI24702J35022_10263820 | 3300002462 | Bacteria | 1006 |
| 187 | Ga0063521_1000130 | 3300003973 | Bacteria | 58438 |
| 188 | Ga0072941_1005122 | 3300005201 | Bacteria | 10650 |
| 189 | Ga0072941_1103278 | 3300005201 | Bacteria | 963 |
| 190 | Ga0466711_280228 | 3300042615 | Bacteria | 44420 |
| 191 | Ga0466715_387240 | 3300042616 | Bacteria | 1977 |
| 192 | Ga0466715_505567 | 3300042616 | Bacteria | 13324 |
| 193 | Ga0466730_058855 | 3300042625 | Bacteria | 1942 |
| 194 | Ga0466703_085348 | 3300042636 | Bacteria | 2107 |
| 195 | Ga0466704_332321 | 3300042643 | Unclassified | 2518 |
| 196 | Ga0466704_546879 | 3300042643 | Bacteria | 1716 |
| 197 | Ga0466706_012779 | 3300042599 | Bacteria | 4798 |
| 198 | Ga0466706_029850 | 3300042599 | Bacteria | 4392 |
| 199 | Ga0466714_087172 | 3300042603 | Bacteria | 1993 |
| 200 | Ga0466714_105059 | 3300042603 | Bacteria | 1866 |
| 201 | Ga0466714_139014 | 3300042603 | Unclassified | 1441 |
| 202 | Ga0466722_232480 | 3300042609 | Bacteria | 4914 |
| 203 | Ga0255808_1117784 | 3300023282 | Bacteria | 515 |
| 204 | Ga0415639_074308 | 3300038395 | Bacteria | 2471 |
| 205 | Ga0466657_148573 | 3300042582 | Bacteria | 3396 |
| 206 | Ga0466694_232943 | 3300042594 | Bacteria | 5152 |
| 207 | Ga0466696_021612 | 3300042596 | Bacteria | 64353 |
| 208 | Ga0123357_10862332 | 3300009784 | Bacteria | 595 |
| 209 | Ga0123355_10029292 | 3300009826 | Bacteria | 8910 |
| 210 | Ga0123355_10042955 | 3300009826 | Bacteria | 7355 |
| 211 | Ga0123355_10623654 | 3300009826 | Bacteria | 1270 |
| 212 | Ga0123355_10695726 | 3300009826 | Bacteria | 1169 |
| 213 | Ga0123355_11824167 | 3300009826 | Bacteria | 572 |
| 214 | Ga0123356_10186091 | 3300010049 | Bacteria | 2103 |
| 215 | Ga0123356_10294017 | 3300010049 | Bacteria | 1726 |
| 216 | Ga0123356_11640237 | 3300010049 | Bacteria | 797 |
| 217 | Ga0123353_10046443 | 3300010167 | Bacteria | 6901 |
| 218 | Ga0123353_10143921 | 3300010167 | Bacteria | 3815 |
| 219 | Ga0123353_10272409 | 3300010167 | Bacteria | 2607 |
| 220 | Ga0123353_10485648 | 3300010167 | Bacteria | 1806 |
| 221 | Ga0123353_11004620 | 3300010167 | Bacteria | 1120 |
| 222 | Ga0123353_11142010 | 3300010167 | Bacteria | 1029 |
| 223 | Ga0123353_11939220 | 3300010167 | Bacteria | 725 |
| 224 | Ga0123353_12222122 | 3300010167 | Unclassified | 663 |
| 225 | Ga0123354_10327454 | 3300010882 | Bacteria | 1403 |
| 226 | Ga0466705_152746 | 3300042612 | Bacteria | 12114 |
| 227 | Ga0466733_203141 | 3300042659 | Bacteria | 2088 |
| 228 | IMNBL1DRAFT_c0000422 | 3300000062 | Bacteria | 35538 |
| 229 | JGI24705J35276_12134200 | 3300002504 | Bacteria | 1115 |
| 230 | Ga0068305_10410200 | 3300005083 | Bacteria | 1322 |
| 231 | Ga0466711_165617 | 3300042615 | Bacteria | 2870 |
| 232 | Ga0466715_538227 | 3300042616 | Bacteria | 4048 |
| 233 | Ga0466723_050061 | 3300042618 | Bacteria | 2813 |
| 234 | Ga0466731_087692 | 3300042622 | Bacteria | 2713 |
| 235 | Ga0466704_270296 | 3300042643 | Bacteria | 7849 |
| 236 | Ga0466704_611680 | 3300042643 | Bacteria | 3571 |
| 237 | Ga0466725_203691 | 3300042654 | Bacteria | 1785 |
| 238 | Ga0466707_256875 | 3300042601 | Bacteria | 1812 |
| 239 | Ga0466707_366979 | 3300042601 | Bacteria | 1735 |
| 240 | Ga0466714_095524 | 3300042603 | Bacteria | 1910 |
| 241 | Ga0466717_146018 | 3300042604 | Bacteria | 11162 |
| 242 | Ga0466716_283921 | 3300042605 | Bacteria | 44945 |
| 243 | Ga0466719_256497 | 3300042606 | Unclassified | 32064 |
| 244 | Ga0466719_488335 | 3300042606 | Bacteria | 2620 |
| 245 | Ga0415639_038553 | 3300038395 | Bacteria | 3339 |
| 246 | Ga0466690_267354 | 3300042590 | Bacteria | 70233 |
| 247 | Ga0123357_10515109 | 3300009784 | Bacteria | 982 |
| 248 | Ga0123355_10019670 | 3300009826 | Bacteria | 10754 |
| 249 | Ga0123356_10454808 | 3300010049 | Bacteria | 1429 |
| 250 | Ga0123356_10999816 | 3300010049 | Bacteria | 1006 |
| 251 | Ga0123356_11855055 | 3300010049 | Bacteria | 750 |
| 252 | Ga0123356_12238523 | 3300010049 | Unclassified | 683 |
| 253 | Ga0123353_10033919 | 3300010167 | Bacteria | 7956 |
| 254 | Ga0123353_10065975 | 3300010167 | Bacteria | 5810 |
| 255 | Ga0123353_10157619 | 3300010167 | Bacteria | 3617 |
| 256 | Ga0123353_10172454 | 3300010167 | Bacteria | 3432 |
| 257 | Ga0123353_10321907 | 3300010167 | Bacteria | 2346 |
| 258 | Ga0123353_10639962 | 3300010167 | Unclassified | 1508 |
| 259 | Ga0123353_10997165 | 3300010167 | Bacteria | 1126 |
| 260 | Ga0123353_11201337 | 3300010167 | Bacteria | 995 |
| 261 | Ga0123353_11554752 | 3300010167 | Bacteria | 839 |
| 262 | Ga0123353_11822296 | 3300010167 | Bacteria | 755 |
| 263 | Ga0123354_10051566 | 3300010882 | Bacteria | 6210 |
| 264 | Ga0466705_309878 | 3300042612 | Bacteria | 1580 |
| 265 | JGI24705J35276_12234253 | 3300002504 | Bacteria | 5368 |
| 266 | JGI24696J40584_12945093 | 3300002834 | Unclassified | 1838 |
| 267 | Ga0068305_11083671 | 3300005083 | Bacteria | 937 |
| 268 | Ga0466715_308526 | 3300042616 | Unclassified | 4222 |
| 269 | Ga0466715_356120 | 3300042616 | Bacteria | 15074 |
| 270 | Ga0466723_130713 | 3300042618 | Bacteria | 2872 |
| 271 | Ga0466728_374321 | 3300042620 | Bacteria | 2817 |
| 272 | Ga0466729_287045 | 3300042621 | Bacteria | 99069 |
| 273 | Ga0466729_290191 | 3300042621 | Bacteria | 5243 |
| 274 | Ga0466704_252842 | 3300042643 | Unclassified | 1202 |
| 275 | Ga0466727_124929 | 3300042655 | Bacteria | 1108 |
| 276 | Ga0466701_055327 | 3300042598 | Bacteria | 1463 |
| 277 | Ga0466714_020081 | 3300042603 | Bacteria | 30959 |
| 278 | Ga0466714_133706 | 3300042603 | Bacteria | 11876 |
| 279 | Ga0466719_376575 | 3300042606 | Unclassified | 7574 |
| 280 | Ga0466719_523800 | 3300042606 | Bacteria | 8558 |
| 281 | Ga0466722_156728 | 3300042609 | Bacteria | 1605 |
| 282 | Ga0466722_167803 | 3300042609 | Bacteria | 4883 |
| 283 | Ga0160433_116830 | 3300012846 | Bacteria | 886 |
| 284 | Ga0415639_027036 | 3300038395 | Bacteria | 1469 |
| 285 | Ga0466690_270374 | 3300042590 | Bacteria | 1125 |
| 286 | Ga0466691_060644 | 3300042593 | Unclassified | 41696 |
| 287 | Ga0123357_10302173 | 3300009784 | Bacteria | 1614 |
| 288 | Ga0123355_10152341 | 3300009826 | Bacteria | 3509 |
| 289 | Ga0123355_10320249 | 3300009826 | Bacteria | 2090 |
| 290 | Ga0123355_11900633 | 3300009826 | Bacteria | 556 |
| 291 | Ga0123356_10133491 | 3300010049 | Bacteria | 2436 |
| 292 | Ga0123356_10593745 | 3300010049 | Bacteria | 1271 |
| 293 | Ga0123356_10626706 | 3300010049 | Bacteria | 1241 |
| 294 | Ga0123356_11351558 | 3300010049 | Bacteria | 874 |
| 295 | Ga0123353_10165320 | 3300010167 | Bacteria | 3518 |
| 296 | Ga0123353_10893241 | 3300010167 | Bacteria | 1211 |
| 297 | Ga0123353_11266970 | 3300010167 | Unclassified | 961 |
| 298 | Ga0123353_12949843 | 3300010167 | Unclassified | 553 |
| 299 | Ga0123354_10149949 | 3300010882 | Bacteria | 2831 |
| 300 | Ga0123354_10672592 | 3300010882 | Unclassified | 732 |
| 301 | Ga0466697_103655 | 3300042611 | Bacteria | 12616 |
| 302 | Ga0466733_075055 | 3300042659 | Bacteria | 6809 |
| 303 | JGI24703J35330_11318491 | 3300002501 | Bacteria | 867 |
| 304 | Ga0072941_1103277 | 3300005201 | Bacteria | 2521 |
| 305 | Ga0466715_042181 | 3300042616 | Bacteria | 63725 |
| 306 | Ga0466718_163165 | 3300042617 | Bacteria | 1212 |
| 307 | Ga0466729_287781 | 3300042621 | Bacteria | 1114 |
| 308 | Ga0466704_474959 | 3300042643 | Bacteria | 73122 |
| 309 | Ga0466708_395453 | 3300042652 | Bacteria | 19642 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.