Protein Family IF00272

Metagenome Metatranscriptome Isolate
364 Members
81 Samples
337 Scaffolds
187.29 Avg Length

🧬 Representative Sequence

ID
3300000089|AustNasuHG_c1001738|AustNasuHG_10017386
Length
187 aa
Sequence
MAAGWYVLHTYSGYENKIEKIIHLMLNAGDLNKEIVKDIKVPQEEVTEVKDGKKRTQKKKFFPGYVLIEMDLPDGLAWKETCSKIKKIQGVTGFVGTPADKRPQPLSGDEARSILQKSGEIKGEKPARSRQVFNSGEQVKIVDGPFESFTGIIEEVNQEKNKLKVMVQIFGRSTPVEVDLLQVEKI*

πŸ“Š Sample Types

Isolate 7.4%
Metagenome 91.5%
MAG 0.0%
Metatranscriptome 1.1%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 44.2%
Unclassified 37.7%
Kalotermitidae 11.7%
Rhinotermitidae 3.9%
Hodotermitidae 1.3%
Termopsidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 313
Eukaryota 0
Viruses 0
Unclassified 51

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
2 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
3 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
4 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
19 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
24 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
25 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
26 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
27 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
30 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
31 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
34 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
35 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
36 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
39 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
43 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
44 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
45 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
46 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
47 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
48 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
49 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
50 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
51 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
52 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
53 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
54 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
55 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
56 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
57 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
58 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
59 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
60 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
61 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
62 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
63 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
64 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
65 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
66 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
67 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
68 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
69 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
70 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
71 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
73 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
74 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
75 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
76 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
77 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
78 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
79 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
80 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
81 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_204600 3300042656 Unclassified 1544
2 Ga0123357_10626516 3300009784 Bacteria 810
3 Ga0123355_10293319 3300009826 Bacteria 2228
4 Ga0123356_10000059 3300010049 Bacteria 117133
5 Ga0123356_10265378 3300010049 Bacteria 1803
6 Ga0123356_11362829 3300010049 Bacteria 871
7 Ga0123353_10475677 3300010167 Bacteria 1830
8 Ga0123354_10080508 3300010882 Bacteria 4610
9 Ga0123354_10276063 3300010882 Bacteria 1643
10 Ga0264413_102639 3300024493 Bacteria 10745
11 Ga0264413_103055 3300024493 Bacteria 33073
12 Ga0466656_020518 3300042550 Bacteria 2088
13 Ga0466693_116944 3300042592 Bacteria 1171
14 Ga0466694_018170 3300042594 Bacteria 6915
15 Ga0466694_187546 3300042594 Unclassified 1366
16 Ga0466694_197848 3300042594 Bacteria 1093
17 Ga0466694_336185 3300042594 Bacteria 1278
18 Ga0466696_332738 3300042596 Bacteria 1839
19 Ga0466699_218362 3300042597 Unclassified 5142
20 Ga0466699_237438 3300042597 Bacteria 1615
21 Ga0466717_181847 3300042604 Bacteria 2116
22 Ga0466717_281807 3300042604 Bacteria 1580
23 Ga0466698_064589 3300042610 Bacteria 1621
24 AustNasuHG_c1036298 3300000089 Bacteria 1281
25 JGI24698J34947_10103252 3300002449 Bacteria 1276
26 JGI24698J34947_10197792 3300002449 Unclassified 790
27 JGI24695J34938_10000099 3300002450 Bacteria 75735
28 JGI24695J34938_10029566 3300002450 Bacteria 2562
29 JGI24695J34938_10159500 3300002450 Bacteria 927
30 Ga0072940_1060124 3300005200 Bacteria 1607
31 Ga0072941_1015790 3300005201 Bacteria 10434
32 Ga0072941_1025006 3300005201 Bacteria 8334
33 Ga0072941_1253401 3300005201 Bacteria 1217
34 Ga0466712_052688 3300042614 Bacteria 9878
35 Ga0466712_069855 3300042614 Unclassified 1850
36 Ga0466718_028994 3300042617 Bacteria 1016
37 Ga0466718_043623 3300042617 Bacteria 13279
38 Ga0466718_053410 3300042617 Bacteria 2115
39 Ga0466702_039841 3300042635 Bacteria 1176
40 Ga0466702_312182 3300042635 Bacteria 13703
41 Ga0466703_294621 3300042636 Bacteria 4686
42 Ga0466708_373925 3300042652 Bacteria 4698
43 Ga0466732_372973 3300042656 Bacteria 2381
44 Ga0123355_10046658 3300009826 Bacteria 7045
45 Ga0123355_10190943 3300009826 Bacteria 3017
46 Ga0123356_11885650 3300010049 Bacteria 744
47 Ga0123353_10302491 3300010167 Bacteria 2440
48 Ga0123353_10466619 3300010167 Bacteria 1853
49 Ga0123353_10704957 3300010167 Bacteria 1416
50 Ga0123353_10763808 3300010167 Bacteria 1343
51 Ga0123353_11158723 3300010167 Unclassified 1019
52 Ga0255786_1016268 3300022815 Bacteria 1548
53 Ga0255809_1013705 3300022820 Unclassified 947
54 Ga0466692_122845 3300042591 Bacteria 2028
55 Ga0466694_091653 3300042594 Bacteria 3284
56 Ga0466694_361599 3300042594 Bacteria 7060
57 Ga0466699_002532 3300042597 Bacteria 37404
58 Ga0466699_056800 3300042597 Bacteria 3349
59 Ga0466699_061797 3300042597 Bacteria 11137
60 Ga0466699_121994 3300042597 Unclassified 4690
61 Ga0466699_180959 3300042597 Bacteria 5301
62 Ga0466699_227845 3300042597 Bacteria 18629
63 Ga0466706_128720 3300042599 Bacteria 33388
64 Ga0466700_480563 3300042600 Bacteria 1910
65 Ga0466717_024252 3300042604 Bacteria 1874
66 Ga0466720_027801 3300042607 Unclassified 1438
67 Ga0466720_097240 3300042607 Bacteria 3000
68 Ga0466720_117754 3300042607 Unclassified 3645
69 Ga0466720_224239 3300042607 Bacteria 1690
70 Ga0466722_108308 3300042609 Bacteria 42621
71 JGI24698J34947_10129037 3300002449 Unclassified 1084
72 JGI24698J34947_10133508 3300002449 Bacteria 1057
73 JGI24698J34947_10189954 3300002449 Unclassified 813
74 JGI24695J34938_10001117 3300002450 Bacteria 24194
75 JGI24695J34938_10033356 3300002450 Bacteria 2369
76 JGI24695J34938_10052193 3300002450 Bacteria 1785
77 JGI24695J34938_10059699 3300002450 Unclassified 1630
78 JGI24695J34938_10061967 3300002450 Bacteria 1590
79 JGI24695J34938_10064072 3300002450 Bacteria 1556
80 JGI24695J34938_10156290 3300002450 Bacteria 936
81 JGI24702J35022_10082753 3300002462 Bacteria 1740
82 JGI24699J35502_10885467 3300002509 Bacteria 1017
83 Ga0072941_1001515 3300005201 Bacteria 7258
84 Ga0466712_010395 3300042614 Bacteria 3559
85 Ga0466712_055464 3300042614 Bacteria 5684
86 Ga0466712_161850 3300042614 Bacteria 3115
87 Ga0466718_004733 3300042617 Bacteria 1029
88 Ga0466718_009965 3300042617 Unclassified 5904
89 Ga0466718_077322 3300042617 Bacteria 31469
90 Ga0466718_148087 3300042617 Unclassified 1067
91 Ga0466702_333979 3300042635 Bacteria 1011
92 Ga0466732_031643 3300042656 Bacteria 29390
93 Ga0123357_10414330 3300009784 Bacteria 1210
94 Ga0123355_10987098 3300009826 Bacteria 897
95 Ga0123356_10900525 3300010049 Bacteria 1056
96 Ga0123356_11750362 3300010049 Bacteria 772
97 Ga0123353_10207036 3300010167 Bacteria 3080
98 Ga0222431_1000874 3300021190 Bacteria 4849
99 Ga0264413_103308 3300024493 Bacteria 2794
100 Ga0264413_111046 3300024493 Unclassified 1111
101 Ga0466692_145799 3300042591 Bacteria 1089
102 Ga0466691_021239 3300042593 Bacteria 18782
103 Ga0466694_174349 3300042594 Bacteria 93398
104 Ga0466694_184480 3300042594 Bacteria 1537
105 Ga0466694_231188 3300042594 Bacteria 1920
106 Ga0466694_355797 3300042594 Bacteria 1581
107 Ga0466699_349766 3300042597 Bacteria 2882
108 Ga0466700_020686 3300042600 Bacteria 1162
109 Ga0466700_356485 3300042600 Bacteria 1752
110 Ga0466700_432681 3300042600 Bacteria 1544
111 Ga0466720_002720 3300042607 Bacteria 3789
112 AustNasuHG_c1007749 3300000089 Bacteria 3811
113 JGI24698J34947_10102220 3300002449 Bacteria 1286
114 JGI24698J34947_10156120 3300002449 Unclassified 941
115 JGI24695J34938_10365659 3300002450 Unclassified 637
116 Ga0072941_1005970 3300005201 Bacteria 6537
117 Ga0072941_1048688 3300005201 Unclassified 5658
118 Ga0072941_1126510 3300005201 Bacteria 1005
119 Ga0466712_055419 3300042614 Bacteria 7618
120 Ga0466712_069791 3300042614 Bacteria 11568
121 Ga0466712_073896 3300042614 Bacteria 1359
122 Ga0466712_084897 3300042614 Bacteria 5641
123 Ga0466712_132527 3300042614 Bacteria 1041
124 Ga0466718_019072 3300042617 Unclassified 1795
125 Ga0466718_080809 3300042617 Bacteria 2173
126 Ga0466718_092121 3300042617 Bacteria 1179
127 Ga0466718_135236 3300042617 Bacteria 5160
128 Ga0466723_005924 3300042618 Bacteria 37995
129 Ga0466723_273986 3300042618 Bacteria 20903
130 Ga0466729_160477 3300042621 Unclassified 1054
131 Ga0466734_124062 3300042623 Bacteria 1138
132 Ga0466702_451074 3300042635 Bacteria 2659
133 Ga0466732_229274 3300042656 Bacteria 1168
134 Ga0466732_361035 3300042656 Bacteria 3093
135 Ga0123356_11414339 3300010049 Bacteria 856
136 Ga0123353_10614320 3300010167 Unclassified 1550
137 Ga0123353_10679580 3300010167 Bacteria 1450
138 Ga0123353_10822134 3300010167 Bacteria 1279
139 Ga0123353_11014775 3300010167 Unclassified 1113
140 Ga0466694_012465 3300042594 Bacteria 5288
141 Ga0466699_022690 3300042597 Bacteria 8057
142 Ga0466699_070921 3300042597 Bacteria 15430
143 Ga0466700_169513 3300042600 Bacteria 3202
144 Ga0466720_005189 3300042607 Bacteria 17082
145 Ga0466720_090599 3300042607 Unclassified 1071
146 Ga0466722_125287 3300042609 Bacteria 12761
147 Ga0466698_016678 3300042610 Bacteria 13071
148 Ga0466698_231259 3300042610 Bacteria 2336
149 Ga0466698_273349 3300042610 Bacteria 1003
150 AustNasuHG_c1033944 3300000089 Bacteria 1377
151 JGI24698J34947_10024407 3300002449 Bacteria 3228
152 JGI24698J34947_10038120 3300002449 Bacteria 2494
153 JGI24698J34947_10123870 3300002449 Bacteria 1117
154 JGI24695J34938_10001073 3300002450 Bacteria 24681
155 JGI24695J34938_10001911 3300002450 Bacteria 16835
156 JGI24695J34938_10003590 3300002450 Bacteria 10673
157 Ga0072941_1001512 3300005201 Bacteria 14728
158 Ga0072941_1005994 3300005201 Bacteria 6278
159 Ga0072941_1023501 3300005201 Bacteria 1435
160 Ga0072941_1053528 3300005201 Bacteria 1789
161 Ga0074263_107154 3300005485 Unclassified 2457
162 Ga0074263_117613 3300005485 Bacteria 1433
163 Ga0074263_144695 3300005485 Bacteria 799
164 Ga0466712_172012 3300042614 Bacteria 6690
165 Ga0466712_219809 3300042614 Bacteria 1039
166 Ga0466712_258938 3300042614 Bacteria 1243
167 Ga0466715_277432 3300042616 Bacteria 20810
168 Ga0466715_546006 3300042616 Bacteria 5528
169 Ga0466718_003503 3300042617 Bacteria 6870
170 Ga0466718_053264 3300042617 Unclassified 5030
171 Ga0466718_166626 3300042617 Unclassified 1539
172 Ga0466708_165937 3300042652 Bacteria 27077
173 Ga0123353_10141834 3300010167 Unclassified 3847
174 Ga0123353_10165590 3300010167 Bacteria 3514
175 Ga0123353_10620050 3300010167 Unclassified 1540
176 Ga0123354_10129185 3300010882 Bacteria 3203
177 Ga0223674_1000786 3300021235 Unclassified 1283
178 Ga0466692_036274 3300042591 Bacteria 5217
179 Ga0466693_236433 3300042592 Bacteria 8743
180 Ga0466694_070967 3300042594 Bacteria 4455
181 Ga0466694_102222 3300042594 Bacteria 1526
182 Ga0466695_313192 3300042595 Bacteria 8298
183 Ga0466699_074338 3300042597 Unclassified 1019
184 Ga0466699_133677 3300042597 Bacteria 1442
185 Ga0466699_413309 3300042597 Bacteria 1102
186 Ga0466700_054318 3300042600 Bacteria 1003
187 Ga0466707_227054 3300042601 Bacteria 1091
188 Ga0466713_067271 3300042602 Bacteria 1131
189 AustNasuHG_c1033629 3300000089 Bacteria 1391
190 JGI24698J34947_10096658 3300002449 Bacteria 1339
191 JGI24695J34938_10049940 3300002450 Unclassified 1837
192 JGI24705J35276_12173779 3300002504 Bacteria 1312
193 JGI24705J35276_12191547 3300002504 Bacteria 1476
194 Ga0072940_1048933 3300005200 Bacteria 3317
195 Ga0074263_116577 3300005485 Bacteria 4593
196 Ga0466718_040010 3300042617 Bacteria 19606
197 Ga0466735_018405 3300042624 Bacteria 3646
198 Ga0466702_066961 3300042635 Bacteria 1744
199 Ga0466703_323758 3300042636 Bacteria 6443
200 Ga0466708_051053 3300042652 Bacteria 51394
201 Ga0123356_10001708 3300010049 Bacteria 24023
202 Ga0123356_10137407 3300010049 Bacteria 2405
203 Ga0123356_10281811 3300010049 Bacteria 1758
204 Ga0123353_10011211 3300010167 Bacteria 12609
205 Ga0123353_10378735 3300010167 Bacteria 2118
206 Ga0123353_10592873 3300010167 Bacteria 1586
207 Ga0123353_11719978 3300010167 Bacteria 784
208 Ga0264413_103307 3300024493 Unclassified 2604
209 Ga0466692_049583 3300042591 Bacteria 7520
210 Ga0466692_157391 3300042591 Bacteria 9170
211 Ga0466693_006037 3300042592 Bacteria 1788
212 Ga0466694_124609 3300042594 Bacteria 1969
213 Ga0466694_175712 3300042594 Bacteria 3185
214 Ga0466695_142529 3300042595 Bacteria 2079
215 Ga0466695_218867 3300042595 Bacteria 114312
216 Ga0466701_096338 3300042598 Bacteria 1180
217 Ga0466722_007214 3300042609 Bacteria 6600
218 Ga0466722_038014 3300042609 Bacteria 1415
219 Ga0466698_236176 3300042610 Bacteria 1361
220 AustNasuHG_c1008001 3300000089 Bacteria 3745
221 JGI24698J34947_10028484 3300002449 Bacteria 2956
222 JGI24698J34947_10055465 3300002449 Unclassified 1974
223 JGI24698J34947_10063525 3300002449 Bacteria 1809
224 JGI24698J34947_10097603 3300002449 Bacteria 1330
225 JGI24698J34947_10143822 3300002449 Unclassified 1000
226 JGI24698J34947_10146155 3300002449 Unclassified 988
227 JGI24695J34938_10002490 3300002450 Bacteria 14041
228 JGI24695J34938_10003663 3300002450 Bacteria 10530
229 JGI24695J34938_10005223 3300002450 Bacteria 8194
230 JGI24695J34938_10029688 3300002450 Bacteria 2554
231 JGI24702J35022_10029978 3300002462 Bacteria 2919
232 Ga0072940_1026346 3300005200 Bacteria 1208
233 Ga0072941_1114860 3300005201 Unclassified 1218
234 Ga0466712_009533 3300042614 Unclassified 1153
235 Ga0466712_095528 3300042614 Unclassified 1792
236 Ga0466712_231936 3300042614 Bacteria 1436
237 Ga0466718_026294 3300042617 Bacteria 8251
238 Ga0466718_072376 3300042617 Bacteria 10012
239 Ga0466718_156256 3300042617 Bacteria 1517
240 Ga0466731_384496 3300042622 Bacteria 13305
241 Ga0466704_002559 3300042643 Bacteria 6127
242 Ga0466704_308552 3300042643 Bacteria 41896
243 Ga0466732_048197 3300042656 Unclassified 4334
244 Ga0466732_208863 3300042656 Unclassified 1789
245 Ga0466732_407284 3300042656 Bacteria 22255
246 Ga0123357_10156664 3300009784 Bacteria 2745
247 Ga0123357_10217591 3300009784 Bacteria 2128
248 Ga0123356_10229441 3300010049 Bacteria 1920
249 Ga0123356_11845488 3300010049 Bacteria 752
250 Ga0264413_125399 3300024493 Unclassified 2226
251 Ga0415639_031191 3300038395 Bacteria 4496
252 Ga0415639_061174 3300038395 Bacteria 1297
253 Ga0466692_161583 3300042591 Bacteria 2404
254 Ga0466694_062007 3300042594 Bacteria 35277
255 Ga0466694_168606 3300042594 Bacteria 2059
256 Ga0466699_210058 3300042597 Bacteria 3431
257 Ga0466699_409875 3300042597 Bacteria 1027
258 Ga0466700_315754 3300042600 Bacteria 1695
259 Ga0466716_356482 3300042605 Bacteria 8232
260 Ga0466720_045202 3300042607 Bacteria 1203
261 Ga0466720_147821 3300042607 Unclassified 1327
262 Ga0466722_001172 3300042609 Bacteria 18968
263 Ga0466722_129601 3300042609 Bacteria 2912
264 Ga0466722_223366 3300042609 Bacteria 60901
265 Ga0466698_276871 3300042610 Bacteria 2107
266 Ga0466698_453430 3300042610 Bacteria 1655
267 AustNasuHG_c1003216 3300000089 Bacteria 5892
268 AustNasuHG_c1027451 3300000089 Bacteria 1737
269 JGI24698J34947_10064998 3300002449 Bacteria 1780
270 JGI24698J34947_10119368 3300002449 Unclassified 1148
271 JGI24695J34938_10008298 3300002450 Bacteria 5938
272 JGI24695J34938_10014173 3300002450 Bacteria 4148
273 JGI24695J34938_10018661 3300002450 Bacteria 3460
274 JGI24695J34938_10021233 3300002450 Bacteria 3180
275 JGI24702J35022_10003691 3300002462 Bacteria 9212
276 Ga0466705_479965 3300042612 Bacteria 20919
277 Ga0466712_020257 3300042614 Bacteria 9948
278 Ga0466712_132883 3300042614 Bacteria 18326
279 Ga0466718_088806 3300042617 Unclassified 1816
280 Ga0466718_141541 3300042617 Bacteria 2784
281 Ga0466729_116250 3300042621 Bacteria 1285
282 Ga0466731_084784 3300042622 Bacteria 1704
283 Ga0466702_178652 3300042635 Bacteria 1528
284 Ga0466702_292803 3300042635 Bacteria 1182
285 Ga0466704_042479 3300042643 Bacteria 5230
286 Ga0466705_279456 3300042612 Bacteria 3291
287 Ga0466732_022588 3300042656 Bacteria 2485
288 Ga0466732_242342 3300042656 Unclassified 1254
289 Ga0466732_258606 3300042656 Bacteria 3332
290 Ga0123357_10141284 3300009784 Bacteria 2958
291 Ga0123355_10008997 3300009826 Bacteria 15135
292 Ga0123356_10004449 3300010049 Bacteria 14496
293 Ga0123353_10569863 3300010167 Bacteria 1628
294 Ga0123353_11975561 3300010167 Unclassified 716
295 Ga0264413_101993 3300024493 Bacteria 8467
296 Ga0264413_101997 3300024493 Bacteria 10794
297 Ga0466692_187209 3300042591 Bacteria 3033
298 Ga0466693_170296 3300042592 Bacteria 2007
299 Ga0466693_358400 3300042592 Bacteria 1213
300 Ga0466694_172229 3300042594 Unclassified 2204
301 Ga0466694_230025 3300042594 Bacteria 1307
302 Ga0466699_096623 3300042597 Bacteria 4240
303 Ga0466699_119680 3300042597 Bacteria 2386
304 Ga0466700_238101 3300042600 Bacteria 1388
305 Ga0466707_083290 3300042601 Bacteria 1577
306 Ga0466720_040340 3300042607 Bacteria 7320
307 Ga0466720_041595 3300042607 Bacteria 5570
308 Ga0466720_119821 3300042607 Bacteria 22326
309 Ga0466720_237601 3300042607 Bacteria 36871
310 AustNasuHG_c1000067 3300000089 Bacteria 28563
311 AustNasuHG_c1001738 3300000089 Bacteria 7870
312 AustNasuHG_c1003903 3300000089 Bacteria 5368
313 AustNasuHG_c1006635 3300000089 Bacteria 4123
314 FAAS_10488909 3300001880 Bacteria 572
315 JGI24698J34947_10000191 3300002449 Bacteria 24630
316 JGI24698J34947_10002376 3300002449 Bacteria 10134
317 JGI24698J34947_10004025 3300002449 Bacteria 7991
318 JGI24698J34947_10039043 3300002449 Bacteria 2460
319 JGI24698J34947_10068005 3300002449 Unclassified 1725
320 JGI24698J34947_10075494 3300002449 Bacteria 1602
321 JGI24698J34947_10158873 3300002449 Bacteria 929
322 JGI24698J34947_10171312 3300002449 Bacteria 878
323 JGI24695J34938_10000419 3300002450 Bacteria 41287
324 JGI24695J34938_10001722 3300002450 Bacteria 18091
325 JGI24695J34938_10002816 3300002450 Bacteria 12700
326 JGI24702J35022_10047695 3300002462 Bacteria 2280
327 JGI24702J35022_10098149 3300002462 Unclassified 1601
328 JGI24697J35500_11258230 3300002507 Unclassified 2844
329 Ga0072941_1091577 3300005201 Bacteria 3573
330 Ga0466712_132951 3300042614 Bacteria 5362
331 Ga0466718_015932 3300042617 Bacteria 2640
332 Ga0466718_054210 3300042617 Bacteria 8618
333 Ga0466718_082761 3300042617 Bacteria 3298
334 Ga0466729_239711 3300042621 Bacteria 1140
335 Ga0466731_086510 3300042622 Bacteria 1113
336 Ga0466702_143572 3300042635 Bacteria 21943
337 Ga0466703_001280 3300042636 Bacteria 3335

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00467 KOW KOW motif 136 165 0.89
PF02357 NusG Transcription termination factor nusG 5 114 0.88

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.