Protein Family IF00183
Metagenome
Isolate
294
Members
141
Samples
225
Scaffolds
256.46
Avg Length
Representative Sequence
- ID
- 3300000036|IMNBGM34_c000855|IMNBGM34_00085510
- Length
- 265 aa
- Sequence
- MAMSLVNQPLVIAGRIFRSRLILGTGKFSSPEAMRDALKASDAEMVTVALRRADLSGKSDPFANILEFIDPKKFLLLPNTSGAMNAEEAVRLARLAVAAGLPKWVKLEIHPDPRFLLPDPIETFKAAEILVKEGFTVLPYINADPVLAKRLQDVGVATVMPLGSPIGSNRGVQTRDQIRIIIEQATVPVVVDAGLGAPSHAAEAMEXGADAALVNTAIAVANDPNKMAIAFKMAVEAGRAAFESGLAAQNEIASATSPLTAFLD*
Sample Types
Isolate
23.5%
Metagenome
76.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
20.3%
Unclassified
17.3%
Kalotermitidae
10.5%
Drosophilidae
9.8%
Elmidae
5.3%
Blattidae
5.3%
Culicidae
4.5%
Armadillidiidae
3.0%
Rhinotermitidae
3.0%
Termopsidae
3.0%
Aphididae
3.0%
Talitridae
2.3%
Passalidae
2.3%
Curculionidae
1.5%
Calliphoridae
0.8%
Hodotermitidae
0.8%
Scarabaeidae
0.8%
Pteromalidae
0.8%
Majidae
0.8%
Cicadellidae
0.8%
Plutellidae
0.8%
Bombycidae
0.8%
Tenebrionidae
0.8%
Hydrophilidae
0.8%
Daphniidae
0.8%
Nephropidae
0.8%
Taxonomy
Archaea
0
Bacteria
277
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 2 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 3 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 4 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 5 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 6 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 7 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 8 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 9 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 10 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 11 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 16 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 17 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 18 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 19 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 20 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 23 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 24 | 2820219087 | Unclassified Ignavibacteria Th196P3bin14 | Isolate | Unclassified |
| 25 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 26 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 27 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 28 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 29 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 30 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 31 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 32 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 33 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 34 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 35 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 36 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 39 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 40 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 41 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 45 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 46 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 47 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 48 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 49 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 50 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 51 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 52 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 53 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 54 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 55 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 56 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 57 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 58 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 59 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 60 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 61 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 62 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 63 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 64 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 65 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 66 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 67 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 68 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 69 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 70 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 71 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 72 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 73 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 74 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 75 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 76 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 77 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 78 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 79 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 80 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 81 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 82 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 83 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 84 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 85 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 86 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 87 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 88 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 89 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 90 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 91 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 92 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 93 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 94 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 95 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 96 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 97 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 98 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 99 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 100 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 101 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 102 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 103 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 104 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 105 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 106 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 107 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
| 108 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 109 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 110 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 111 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 112 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 113 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 114 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 115 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 116 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 117 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 118 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 119 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 120 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 121 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 122 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 123 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 124 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 125 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 126 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 127 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 128 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 129 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 130 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 131 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 132 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 133 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 134 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 135 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 136 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 137 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 138 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 139 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 140 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 141 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_048456 | 3300042598 | Unclassified | 3275 |
| 2 | Ga0466701_050423 | 3300042598 | Bacteria | 264361 |
| 3 | Ga0466713_078173 | 3300042602 | Bacteria | 3101 |
| 4 | Ga0466719_448546 | 3300042606 | Bacteria | 7939 |
| 5 | Ga0466722_043359 | 3300042609 | Bacteria | 6755 |
| 6 | Ga0123353_10212514 | 3300010167 | Unclassified | 3033 |
| 7 | Ga0265387_1000779 | 3300024582 | Bacteria | 4864 |
| 8 | Ga0466696_381639 | 3300042596 | Bacteria | 10859 |
| 9 | Ga0466699_318704 | 3300042597 | Bacteria | 3023 |
| 10 | Ga0466730_038995 | 3300042625 | Unclassified | 1637 |
| 11 | Ga0466704_355455 | 3300042643 | Bacteria | 11006 |
| 12 | Ga0466708_358272 | 3300042652 | Bacteria | 9660 |
| 13 | Ga0466727_288891 | 3300042655 | Bacteria | 3148 |
| 14 | Ga0466727_345067 | 3300042655 | Bacteria | 4249 |
| 15 | Ga0466711_443278 | 3300042615 | Bacteria | 16399 |
| 16 | Ga0466723_158449 | 3300042618 | Bacteria | 5682 |
| 17 | Ga0466723_271020 | 3300042618 | Bacteria | 15025 |
| 18 | Ga0466701_041246 | 3300042598 | Bacteria | 2650 |
| 19 | Ga0466707_276793 | 3300042601 | Bacteria | 46447 |
| 20 | Ga0466707_320715 | 3300042601 | Bacteria | 41799 |
| 21 | Ga0466716_278346 | 3300042605 | Bacteria | 13977 |
| 22 | Ga0466719_313001 | 3300042606 | Bacteria | 17722 |
| 23 | Ga0466719_367851 | 3300042606 | Bacteria | 1501 |
| 24 | Ga0466720_085774 | 3300042607 | Bacteria | 1183 |
| 25 | Ga0466690_106262 | 3300042590 | Bacteria | 10195 |
| 26 | Ga0466696_009857 | 3300042596 | Bacteria | 13158 |
| 27 | Ga0466696_138633 | 3300042596 | Bacteria | 1680 |
| 28 | Ga0466701_008548 | 3300042598 | Bacteria | 2464 |
| 29 | Ga0466724_08482 | 3300042649 | Unclassified | 10860 |
| 30 | Ga0466724_18051 | 3300042649 | Unclassified | 9821 |
| 31 | Ga0466708_087532 | 3300042652 | Bacteria | 8875 |
| 32 | Ga0466727_244066 | 3300042655 | Bacteria | 7492 |
| 33 | JGI24699J35502_11133086 | 3300002509 | Bacteria | 8620 |
| 34 | Ga0068302_10116616 | 3300005071 | Bacteria | 9437 |
| 35 | Ga0104048_1003135 | 3300007143 | Bacteria | 6332 |
| 36 | Ga0466712_048562 | 3300042614 | Bacteria | 1110 |
| 37 | Ga0466711_040042 | 3300042615 | Bacteria | 4069 |
| 38 | Ga0466715_254438 | 3300042616 | Unclassified | 2915 |
| 39 | Ga0466726_019987 | 3300042619 | Bacteria | 6303 |
| 40 | Ga0466729_118859 | 3300042621 | Unclassified | 4781 |
| 41 | Ga0466705_017139 | 3300042612 | Bacteria | 4995 |
| 42 | Ga0466733_001132 | 3300042659 | Bacteria | 20153 |
| 43 | Ga0466733_079294 | 3300042659 | Bacteria | 2558 |
| 44 | Ga0466701_022365 | 3300042598 | Bacteria | 5326 |
| 45 | Ga0466701_057346 | 3300042598 | Bacteria | 32176 |
| 46 | Ga0466714_163658 | 3300042603 | Bacteria | 2966 |
| 47 | Ga0466716_257039 | 3300042605 | Bacteria | 18620 |
| 48 | Ga0466716_298346 | 3300042605 | Bacteria | 1473 |
| 49 | Ga0466716_418955 | 3300042605 | Bacteria | 1113 |
| 50 | Ga0466722_079164 | 3300042609 | Bacteria | 11033 |
| 51 | Ga0466722_126233 | 3300042609 | Bacteria | 1415 |
| 52 | Ga0123356_10088836 | 3300010049 | Bacteria | 2939 |
| 53 | Ga0160457_1014821 | 3300012858 | Bacteria | 1099 |
| 54 | Ga0466690_152782 | 3300042590 | Bacteria | 8362 |
| 55 | Ga0466692_042283 | 3300042591 | Bacteria | 3074 |
| 56 | Ga0466696_348767 | 3300042596 | Bacteria | 38138 |
| 57 | Ga0466731_306770 | 3300042622 | Bacteria | 1095 |
| 58 | Nasutiter_Contig22471 | 2030936001 | Bacteria | 1417 |
| 59 | JGI24702J35022_10022418 | 3300002462 | Unclassified | 3417 |
| 60 | JGI24702J35022_10023850 | 3300002462 | Bacteria | 3307 |
| 61 | Ga0063521_1000120 | 3300003973 | Bacteria | 59713 |
| 62 | Ga0104048_1168509 | 3300007143 | Unclassified | 4229 |
| 63 | Ga0105005_1091804 | 3300007505 | Bacteria | 3018 |
| 64 | Ga0466711_083435 | 3300042615 | Bacteria | 5439 |
| 65 | Ga0466715_009253 | 3300042616 | Bacteria | 12900 |
| 66 | Ga0466715_124966 | 3300042616 | Bacteria | 11966 |
| 67 | Ga0466715_162017 | 3300042616 | Unclassified | 1900 |
| 68 | Ga0466715_260961 | 3300042616 | Unclassified | 3072 |
| 69 | Ga0466715_547292 | 3300042616 | Bacteria | 18655 |
| 70 | Ga0466723_136042 | 3300042618 | Bacteria | 5576 |
| 71 | Ga0466723_305697 | 3300042618 | Bacteria | 6515 |
| 72 | Ga0466733_124194 | 3300042659 | Bacteria | 2466 |
| 73 | Ga0466701_078801 | 3300042598 | Bacteria | 2499 |
| 74 | Ga0466706_223165 | 3300042599 | Bacteria | 1798 |
| 75 | Ga0466713_059022 | 3300042602 | Bacteria | 11965 |
| 76 | Ga0466713_091714 | 3300042602 | Bacteria | 189911 |
| 77 | Ga0466714_016718 | 3300042603 | Bacteria | 43278 |
| 78 | Ga0466714_076324 | 3300042603 | Bacteria | 2301 |
| 79 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 80 | Ga0466722_010278 | 3300042609 | Bacteria | 34572 |
| 81 | Ga0466722_156297 | 3300042609 | Bacteria | 10799 |
| 82 | Ga0123353_10875326 | 3300010167 | Bacteria | 1227 |
| 83 | Ga0160467_100065 | 3300012829 | Bacteria | 157258 |
| 84 | Ga0160433_100032 | 3300012846 | Bacteria | 165473 |
| 85 | Ga0466690_056112 | 3300042590 | Bacteria | 5808 |
| 86 | Ga0466691_091133 | 3300042593 | Bacteria | 7538 |
| 87 | Ga0466691_100262 | 3300042593 | Bacteria | 17526 |
| 88 | Ga0466694_371162 | 3300042594 | Bacteria | 6005 |
| 89 | Ga0466735_168005 | 3300042624 | Bacteria | 3337 |
| 90 | Ga0466730_039992 | 3300042625 | Bacteria | 1355215 |
| 91 | Ga0466703_000829 | 3300042636 | Bacteria | 10218 |
| 92 | Ga0466703_137088 | 3300042636 | Bacteria | 5339 |
| 93 | Ga0466724_17151 | 3300042649 | Bacteria | 17956 |
| 94 | IMNBL1DRAFT_c0056999 | 3300000062 | Bacteria | 1195 |
| 95 | JGI24702J35022_10067493 | 3300002462 | Bacteria | 1921 |
| 96 | JGI24702J35022_10113659 | 3300002462 | Bacteria | 1490 |
| 97 | Ga0063521_1000313 | 3300003973 | Bacteria | 29434 |
| 98 | Ga0104048_1002529 | 3300007143 | Bacteria | 5737 |
| 99 | Ga0105553_1000079 | 3300007767 | Bacteria | 4560 |
| 100 | Ga0466705_523440 | 3300042612 | Bacteria | 3164 |
| 101 | Ga0466711_473693 | 3300042615 | Bacteria | 29038 |
| 102 | Ga0466715_546483 | 3300042616 | Bacteria | 18843 |
| 103 | Ga0466723_021164 | 3300042618 | Bacteria | 6562 |
| 104 | Ga0466723_187156 | 3300042618 | Bacteria | 12048 |
| 105 | Ga0466726_079628 | 3300042619 | Bacteria | 30093 |
| 106 | Ga0466728_134198 | 3300042620 | Bacteria | 1213 |
| 107 | Ga0466728_406855 | 3300042620 | Bacteria | 92553 |
| 108 | Ga0466733_156326 | 3300042659 | Bacteria | 4583 |
| 109 | Ga0466701_059126 | 3300042598 | Bacteria | 160039 |
| 110 | Ga0466706_106379 | 3300042599 | Bacteria | 42196 |
| 111 | Ga0466706_209957 | 3300042599 | Bacteria | 25712 |
| 112 | Ga0466714_039799 | 3300042603 | Bacteria | 1104 |
| 113 | Ga0466714_081910 | 3300042603 | Bacteria | 17725 |
| 114 | Ga0466716_158056 | 3300042605 | Bacteria | 3401 |
| 115 | Ga0466721_307936 | 3300042608 | Bacteria | 2384 |
| 116 | Ga0466722_237438 | 3300042609 | Bacteria | 4635 |
| 117 | Ga0123356_10746755 | 3300010049 | Bacteria | 1148 |
| 118 | Ga0160441_100315 | 3300012825 | Bacteria | 43885 |
| 119 | Ga0466690_122605 | 3300042590 | Bacteria | 9257 |
| 120 | Ga0466690_127987 | 3300042590 | Bacteria | 6828 |
| 121 | Ga0466696_004522 | 3300042596 | Bacteria | 1153 |
| 122 | Ga0466696_122487 | 3300042596 | Bacteria | 3453 |
| 123 | Ga0466703_430486 | 3300042636 | Bacteria | 9195 |
| 124 | Ga0466709_003271 | 3300042648 | Bacteria | 25250 |
| 125 | Ga0466727_192464 | 3300042655 | Bacteria | 5127 |
| 126 | IMNBGM34_c000855 | 3300000036 | Bacteria | 6806 |
| 127 | JGI24702J35022_10082483 | 3300002462 | Bacteria | 1743 |
| 128 | Ga0104045_1000059 | 3300007085 | Bacteria | 10341 |
| 129 | Ga0104045_1004252 | 3300007085 | Bacteria | 28209 |
| 130 | Ga0104019_1192930 | 3300007150 | Bacteria | 1529 |
| 131 | Ga0104050_1026551 | 3300007153 | Bacteria | 3407 |
| 132 | Ga0105553_1105802 | 3300007767 | Unclassified | 8301 |
| 133 | Ga0466715_635823 | 3300042616 | Bacteria | 16106 |
| 134 | Ga0466728_051744 | 3300042620 | Bacteria | 107334 |
| 135 | Ga0466728_306930 | 3300042620 | Bacteria | 116996 |
| 136 | Ga0466705_071460 | 3300042612 | Bacteria | 7663 |
| 137 | Ga0466705_282445 | 3300042612 | Bacteria | 31268 |
| 138 | Ga0466732_133440 | 3300042656 | Bacteria | 22850 |
| 139 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 140 | Ga0466701_044424 | 3300042598 | Bacteria | 22119 |
| 141 | Ga0466701_088486 | 3300042598 | Unclassified | 4794 |
| 142 | Ga0466713_025848 | 3300042602 | Bacteria | 19465 |
| 143 | Ga0466713_042559 | 3300042602 | Bacteria | 33969 |
| 144 | Ga0466713_083116 | 3300042602 | Bacteria | 16891 |
| 145 | Ga0466714_013813 | 3300042603 | Bacteria | 151010 |
| 146 | Ga0466714_086437 | 3300042603 | Bacteria | 1322 |
| 147 | Ga0466714_131596 | 3300042603 | Bacteria | 1855 |
| 148 | Ga0466717_250983 | 3300042604 | Bacteria | 4768 |
| 149 | Ga0466716_410837 | 3300042605 | Bacteria | 7916 |
| 150 | Ga0123355_10798290 | 3300009826 | Bacteria | 1053 |
| 151 | Ga0123354_10001509 | 3300010882 | Unclassified | 28475 |
| 152 | Ga0247290_00351 | 3300035364 | Bacteria | 9905 |
| 153 | Ga0466690_035616 | 3300042590 | Bacteria | 5833 |
| 154 | Ga0466692_158900 | 3300042591 | Bacteria | 8003 |
| 155 | Ga0466691_024005 | 3300042593 | Bacteria | 6918 |
| 156 | Ga0466691_216514 | 3300042593 | Bacteria | 2765 |
| 157 | Ga0466695_316533 | 3300042595 | Bacteria | 1748 |
| 158 | Ga0466734_042604 | 3300042623 | Bacteria | 1132 |
| 159 | Ga0466735_012916 | 3300042624 | Bacteria | 6334 |
| 160 | Ga0466730_096235 | 3300042625 | Unclassified | 1565 |
| 161 | Ga0466703_106442 | 3300042636 | Bacteria | 4256 |
| 162 | Ga0466704_065354 | 3300042643 | Bacteria | 26743 |
| 163 | Ga0466709_041564 | 3300042648 | Bacteria | 14682 |
| 164 | Ga0466708_077917 | 3300042652 | Bacteria | 14021 |
| 165 | Ga0466725_225897 | 3300042654 | Bacteria | 3328 |
| 166 | IMNBL1DRAFT_c0000940 | 3300000062 | Bacteria | 22462 |
| 167 | AustNasuHG_c1005880 | 3300000089 | Bacteria | 4383 |
| 168 | JGI24702J35022_10000991 | 3300002462 | Bacteria | 17791 |
| 169 | Meta3P_1003558 | 3300002464 | Bacteria | 20998 |
| 170 | Ga0104050_1001138 | 3300007153 | Bacteria | 4931 |
| 171 | Ga0466711_082459 | 3300042615 | Bacteria | 5635 |
| 172 | Ga0466723_195938 | 3300042618 | Unclassified | 10866 |
| 173 | Ga0466726_259816 | 3300042619 | Bacteria | 17666 |
| 174 | Ga0466728_109960 | 3300042620 | Bacteria | 9445 |
| 175 | Ga0466728_353515 | 3300042620 | Bacteria | 39872 |
| 176 | Ga0466713_042236 | 3300042602 | Bacteria | 30468 |
| 177 | Ga0466714_080397 | 3300042603 | Bacteria | 34841 |
| 178 | Ga0466719_021395 | 3300042606 | Bacteria | 7561 |
| 179 | Ga0466722_259643 | 3300042609 | Bacteria | 3364 |
| 180 | Ga0123356_10512818 | 3300010049 | Bacteria | 1357 |
| 181 | Ga0160455_100103 | 3300012837 | Bacteria | 125922 |
| 182 | Ga0466690_029252 | 3300042590 | Bacteria | 22378 |
| 183 | Ga0466692_182007 | 3300042591 | Bacteria | 11559 |
| 184 | Ga0466696_280473 | 3300042596 | Bacteria | 12933 |
| 185 | Ga0466729_243763 | 3300042621 | Bacteria | 27150 |
| 186 | Ga0466729_292585 | 3300042621 | Bacteria | 3839 |
| 187 | Ga0466704_110461 | 3300042643 | Bacteria | 5058 |
| 188 | Ga0466704_127471 | 3300042643 | Bacteria | 3505 |
| 189 | Ga0466704_484120 | 3300042643 | Bacteria | 19472 |
| 190 | Ga0466709_164117 | 3300042648 | Bacteria | 18385 |
| 191 | Ga0466724_23916 | 3300042649 | Bacteria | 557842 |
| 192 | Ga0466724_56031 | 3300042649 | Bacteria | 124853 |
| 193 | 2227469105 | 2225789004 | Bacteria | 4975 |
| 194 | JGI24696J40584_12950330 | 3300002834 | Unclassified | 2142 |
| 195 | Ga0104048_1003488 | 3300007143 | Bacteria | 6512 |
| 196 | Ga0466715_058785 | 3300042616 | Bacteria | 6906 |
| 197 | Ga0466728_287911 | 3300042620 | Bacteria | 4150 |
| 198 | Ga0466728_352932 | 3300042620 | Bacteria | 10668 |
| 199 | Ga0466729_092496 | 3300042621 | Bacteria | 1921 |
| 200 | Ga0466705_001563 | 3300042612 | Bacteria | 3239 |
| 201 | Ga0466732_017651 | 3300042656 | Bacteria | 3383 |
| 202 | Ga0466733_016323 | 3300042659 | Bacteria | 17143 |
| 203 | Ga0466733_143369 | 3300042659 | Bacteria | 27642 |
| 204 | Ga0466733_176936 | 3300042659 | Bacteria | 32749 |
| 205 | Ga0466701_025482 | 3300042598 | Bacteria | 168021 |
| 206 | Ga0466706_028017 | 3300042599 | Bacteria | 30169 |
| 207 | Ga0466706_048701 | 3300042599 | Bacteria | 7199 |
| 208 | Ga0466714_085495 | 3300042603 | Bacteria | 1374 |
| 209 | Ga0466722_084128 | 3300042609 | Bacteria | 2938 |
| 210 | Ga0466722_171330 | 3300042609 | Bacteria | 18617 |
| 211 | Ga0123355_10918772 | 3300009826 | Bacteria | 947 |
| 212 | Ga0160470_100001 | 3300012813 | Bacteria | 1272206 |
| 213 | Ga0160441_100058 | 3300012825 | Bacteria | 149157 |
| 214 | Ga0466657_235385 | 3300042582 | Bacteria | 81858 |
| 215 | Ga0466693_149653 | 3300042592 | Bacteria | 1060 |
| 216 | Ga0466691_096919 | 3300042593 | Bacteria | 22323 |
| 217 | Ga0466696_259201 | 3300042596 | Bacteria | 7722 |
| 218 | Ga0466696_359570 | 3300042596 | Bacteria | 7819 |
| 219 | Ga0466730_103185 | 3300042625 | Bacteria | 215676 |
| 220 | Ga0466724_23794 | 3300042649 | Bacteria | 25951 |
| 221 | JGI24702J35022_10026682 | 3300002462 | Bacteria | 3110 |
| 222 | JGI24702J35022_10193849 | 3300002462 | Bacteria | 1160 |
| 223 | Ga0104041_1001704 | 3300007106 | Bacteria | 2987 |
| 224 | Ga0104019_1000935 | 3300007150 | Bacteria | 4119 |
| 225 | Ga0466723_096996 | 3300042618 | Bacteria | 12042 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05690 | ThiG | Thiazole biosynthesis protein ThiG | 12 | 258 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.